SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_I3108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_I3108
Domain Number 1 Region: 747-952
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.59e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 33-215
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.18e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.064
Further Details:      
 
Domain Number 3 Region: 461-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.07e-17
Family Pyruvate oxidase and decarboxylase PP module 0.043
Further Details:      
 
Weak hits

Sequence:  271848.BTH_I3108
Domain Number - Region: 280-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000246
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_I3108
Sequence length 1193
Comment (Burkholderia thailandensis E264)
Sequence
MNAPLDAGQRASLEAALQSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDRAAGLNTA
GFISGYRGSPLGGLDLSLWKAKRHLAAHRIVFQPGLNEDLAATAVWGSQQVNLYPGAKYD
GVFAMWYGKGPGVDRTGDVFKHANSAGSAPHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVESSASVDIDPHRTEIVLPTD
FILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIDSPNARFGIMTGGKA
YLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQAFARGLDEILVVEEKRQILE
YAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
DKFELPSDVRARIAARIAVIEAKETALAKPHVSTERKPWFCSGCPHNTSTNVPEGSRAIA
GIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDEKHVFANLGDGTYFHSGLLAIRAA
IASKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLASEGAKKIAIVTDEPQKYDGHQ
SLLAPGVTIHHRDQLDDVQRTLRDIEGTTLLIYDQTCATEKRRRRKRGAYPDPAKRVVIN
EAVCEGCGDCSVQSNCLSVEPLDTEFGTKRQINQSTCNKDFSCVKGFCPSFVTVEGGKLR
KPKAVSADASALPPIPEPALPAIDRAYGVLVTGVGGTGVVTIGALLGMAAHLEGKGVTVL
DVTGLAQKGGAVMSHVQISHAPADIHATRIAMGEADLVIGCDAIVTAGDECTSRMRHGAT
RVVVNSAKTPTAEFIKNPKWTFPGASAESDIRAAAGDAVDLVDANRFAVALLGDAIYTNP
FVLGYAWQRGWLPLAYASLVRAIELNGVQIEQNRAAFEWGRRAAFDPASVRAATAGDAQT
GATVISLHTKKAIDALIATRAEHLRAYQNAAYAARFSAVVGKVRDVERALGADTAQEPLT
EAVARNLYKLMAYKDEYEVARLHADPAFVAKLAEQFEGDWKLKFHLAPPLFAKKDAHGRL
VKKQYGPWLMPAFRVLAKLKFLRGTAFDVFGRAEERRTERALIGEYETLVKELTGSRLTR
DTLPLAIELASLPDGIRGYGHVKENNLRAVRAKWAQLLAQWRSPEGGQTRNVA
Download sequence
Identical sequences A0A2C5VZQ1 Q2STZ6
gi|83721446|ref|YP_443603.1| 271848.BTH_I3108 WP_009888221.1.101337 WP_009888221.1.21694 WP_009888221.1.28912 WP_009888221.1.31764 WP_009888221.1.44093 WP_009888221.1.49905 WP_009888221.1.68421 WP_009888221.1.6992 WP_009888221.1.7190 WP_009888221.1.83779 WP_009888221.1.8909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]