SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_II1805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_II1805
Domain Number 1 Region: 101-287
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.23e-23
Family Biotin dependent carboxylase carboxyltransferase domain 0.07
Further Details:      
 
Domain Number 2 Region: 506-544
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000353
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_II1805
Sequence length 557
Comment (Burkholderia thailandensis E264)
Sequence
MARDEPRRLPRRRARRARGRFALSPETAYSLSTGRTPFSRPGCGAAPCGRAPPADTAMQT
PHPSPRPPPRHGRLAARLARAAVLIGLLLACAAAAAATRAPVVVIPVTGAIGPASADFIV
RGLERAARERAQLAIVQLDTPGGLDTSMRQIIKAIVGSGVPVAAFVAPGGARAASAGTYI
VYASHIAAMAPGTNLGAASPVQLGIGGRAPPAARREPGAASGASGAGAADAESTETRKAM
QDAAAYIRGLAQLRGRNADWAERAVREAVSLPASDALAQHVVDLIANDPADLAAKLDGRK
VVTATGAHWLDTAHAPIETIEPDWRSRLLATVADPSVALVLVTLGMYGLFFEFANPGFVL
PGVAGAISLLVGLFALQMLPISYAGLALVLLGIAFLIAEAFLPTFGTLGVGGIVAFAIGA
LMLIDTDVPGYGVPWPVIASLAAAGTILVFGVSGFALRARRRPVVTGAEAIVGSIGEVLD
DGLVPDQPPQVGPSADPAAPLAPSAAGWARVHGERWRVASATPIAAGRRVRVTGRSGLTL
TVAPLYDHTAPTQGEPS
Download sequence
Identical sequences Q2T4A0
271848.BTH_II1805 gi|83716454|ref|YP_439999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]