SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272557.APE_0712.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_0712.1
Domain Number 1 Region: 114-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.29e-58
Family D-glucarate dehydratase-like 0.00000195
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.4e-32
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_0712.1
Sequence length 375
Comment (Aeropyrum pernix)
Sequence
MEVVRLEVFEVWMPLVSEFRTSFGSTRLRPALLVRAVEKGGEEGWGEVVAGEGPWYSSET
VWTAWHVIEDYIARLLPSTIEHPREVGGRLSRIRGHNMAKAGVEMALWDLKARMESKPLW
SLIGGVKRDVSVGVSVGIQPSIEDLVRTVSRYLEEGYGRIKIKIEPGWDLEPVEALRREF
PDVPLQVDANAAYTFLDAPRLSRLDDYGLLMIEQPFHHDDLLEHAHFQSMVRTPVCLDES
VKSVRDAVAALKLGSARVINIKPGRVGGIASSLEIHDFWSLKAHLPVWIGGMLETGVGRG
HLVALGTLPGVRYPSDISASRRYYMEDIVDEPWELERGSVIRARSRPGIGVEVDWGRLNK
YVKKSRRLSLQGKAS
Download sequence
Identical sequences Q9YE58
272557.APE_0712.1 gi|118431164|ref|NP_147436.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]