SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272557.APE_1473.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_1473.1
Domain Number 1 Region: 238-507
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-56
Family PFOR Pyr module 0.0081
Further Details:      
 
Domain Number 2 Region: 5-258
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.58e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0066
Further Details:      
 
Domain Number 3 Region: 522-638
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.75e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_1473.1
Sequence length 642
Comment (Aeropyrum pernix)
Sequence
MVDISLIIGGPQGGGIESAGQIAIKSMVLLGYEVLGSREYHSNIMGAHSYYHLRVQQHRP
RSLKLPVDGVLALDAESVFTHFRDVRPGGILVYDPGTKSTRVDAIQPMAGPLKKRLKSLF
DSRGMQPVVESAVKLAEEAGARIVGLPLKEMLKTLSERTGAPVARVSRALNTLGLASMLY
MLGVPVEYIEKAISLQFAGKEKVINMNVEAVRIAVDYVREAFGEPESRLPPGPRRGQTMM
VATGNDLVAMGKIVGGLGVITYYPITPSSDEALYVEKHSYISIDGPLAEKLGYDKIAVAI
VQMEDELASINAVLGAAAAGARASTTTSGPGFSLMNEAVSLAVEAEIPVVVTLWMRAGPS
TGMPTRTGQQDLLHSIFSGHGDAPKIVLASGDHVEAFYDAIKAFNWAEEFQTPVIHLLDK
YLASSMVSLAREDLDPSKVPITRGKLLDNPPADYRRYEVVEDGISPRARLGSATMVITGL
EHDEYGYATEDPVMREIMMFKRERKFKVIEERIPDEEKAVLHGDSEASVALVSFGSTKQP
ILEALEMLRDEGVRARFAQVRLLYPFPGRLVEEMLEGVEKVIMVEQNLLGQLAMLLRAHT
SIKPDSSIVKINGRPLYSFEVAGAVKRILETGEERVVVSHGS
Download sequence
Identical sequences Q9YBX7
272557.APE_1473.1 gi|118431469|ref|NP_147967.2| APC66939.0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]