SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272557.APE_2151.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_2151.1
Domain Number 1 Region: 87-249
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.11e-24
Family Clp protease, ClpP subunit 0.032
Further Details:      
 
Domain Number 2 Region: 432-491
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000183
Family NfeD domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_2151.1
Sequence length 503
Comment (Aeropyrum pernix)
Sequence
MESMGKAGLKRFLPLLTTAGLLLALALAFAATYAKAQETVETTTTTAGEQPVPGKADFES
LVKECKAYEKKFGIMPDATSYERVVGPKALIIRIEGTIDNAMMDYLKQSIERAEEENAVL
IVELNTPGGFVDAATEMVVSISKARIPVVGYVVEKWAESAGTMILMSTHIAAMQPGTIIG
SVQPIAYDPTTGSYQPVLDSKIINPIVKTLCEHGATRGRNPEALVRFVLYNDNYGAEEAL
EKGVIDLIARDRSELLQLIDGKVVRLPIGETVLIDVNGSYEVLEPDLRIRVLHSLSDPML
SGILLSIGALALLFSIASGNLPGIALGGFLLVLGLVGSGFNPNTAALILIIGGAILVFIE
LYTPGFGIIGGTGIAMLVFGVILLPIRGEGFAVGESYAKTLLYTTYALGATMGGLTAFVV
YKVVKAKRAPQTLWKLKGAVGEAVDDIPEGGTGFILVEGEYWKAKAITPVARGDKVVVVD
KEGPYLVVKKAEESVEEDEAHTR
Download sequence
Identical sequences Q9Y9Y8
gi|118431752|ref|NP_148417.2| 272557.APE_2151.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]