SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272557.APE_2356.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_2356.1
Domain Number 1 Region: 60-126
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000157
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_2356.1
Sequence length 130
Comment (Aeropyrum pernix)
Sequence
MAGRLLVLVALLDEAAVILIVVGGAAYMAERLGLASPLEAAVMVSPIALFLAVAAAKAVE
AMGRKPSVGPDALEGLKGRVVEVREGGRVVVEIEGELWRGVLLRGSVRPGDVVVVRGSRG
LLLLVEPGDG
Download sequence
Identical sequences Q9Y9D1
272557.APE_2356.1 gi|118431844|ref|NP_148562.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]