SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH0523 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH0523
Domain Number 1 Region: 153-260
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.94e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0523
Sequence length 271
Comment (Bacillus halodurans)
Sequence
MESFIVSFVNEKKDELVKQWESELHQIRSEIYLDKISDDLFLRTSQEFMEHTFAAIQTSQ
QEAGERLAPFTERLIQGGWPLIYFTKGLQAFRRTVLAVLAEEKDLQQVLKYFYEVEEWVD
RMVNELVHDYTGSWEDTIEMQKLSLLELSAPLMPVFEGVTVMPLIGTIDTQRAKLIMENL
LDGVIKHRSQVVLIDITGVPVVDTMVAHHIIQAAEAVRLVGAQCILVGIRPEIAQTIVNL
GINLQQFPTKSTLQKGIEAALEQLGKKMVDK
Download sequence
Identical sequences Q9KFF6
WP_010896701.1.28103 272558.BH0523 gi|15613086|ref|NP_241389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]