SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH0524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH0524
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-21
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0524
Sequence length 118
Comment (Bacillus halodurans)
Sequence
MRIPILKLKQYLLISIQVELDDQTALRFQEDLLTKIHQEGSEGVVIDLTSVETIDSFIAK
VLGDVVNMANLMGAKVVLTGIQPAVAITLIDMGIKLENVPTALDLDQGLEKLQQELEG
Download sequence
Identical sequences Q9KFF5
gi|15613087|ref|NP_241390.1| 272558.BH0524 APC64590 WP_010896702.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]