SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH0594 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH0594
Domain Number 1 Region: 128-281
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.97e-27
Family Rob transcription factor, C-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 57-116
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000851
Family AraC type transcriptional activator 0.0096
Further Details:      
 
Domain Number 3 Region: 5-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000305
Family AraC type transcriptional activator 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0594
Sequence length 281
Comment (Bacillus halodurans)
Sequence
MDWLKRMNGAMAYIEEHLTGDIDYREVARIACCSEYHFKRMFSFIAGVTLSEYIRRRRLT
LAAFELKNSQMKVIDVAVKYGYHSPDAFTRAFQSVHGITPTEARNNGHSLKAYPAMTFHI
SIKGGTEMNYRMEQKEAFRVVGMKKRVKLVHRGTNTDITDMLGTISDETYMQIENLSTLE
PGGILNVCTNFSEGLEDEGELDYYIAAATIKKCPEHLVELEIPTFTWAVFTVEGSWEDVQ
EMWGRIYSDWFPTSDYEHAEGPEILSSANEKSEIWIPVVKK
Download sequence
Identical sequences Q9KF91
272558.BH0594 gi|15613157|ref|NP_241460.1| WP_010896771.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]