SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH1405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH1405
Domain Number 1 Region: 150-209
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000183
Family NfeD domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272558.BH1405
Sequence length 216
Comment (Bacillus halodurans)
Sequence
MEWLDIASVGFVVVLLGTLFLFGELLVRAKGLFGLLGVAIMSFYFSHHLTGDTGFWVVIL
YLVGLALIMVDGKVISDGTIALLGIALMIVGLAVPSPSVIYGILVGMGFLVGGFGSALFL
KVFPSRNMWSKMTLRDRLTGDQGYNSMNEEYKSLIGKRGKTITPFRPTGSVEIEGKPYSA
TSGSHWLQENEQVEVVSVSGTYILVKKIEEQDIEDK
Download sequence
Identical sequences Q9KD14
WP_010897570.1.28103 272558.BH1405 gi|15613968|ref|NP_242271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]