SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH3534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH3534
Domain Number 1 Region: 25-84
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000121
Family Cgl2762-like 0.09
Further Details:      
 
Weak hits

Sequence:  272558.BH3534
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0615
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH3534
Sequence length 159
Comment (Bacillus halodurans)
Sequence
MRGKRGKYHQWITKEGLLKIEGWARDGLTNEQIAKNIGINPDTLYTWIKRFPEISEVLKK
GKEVVDREVENALLKRALGYEYEEVKTYIEESDGKKKKRVEKTVKHVPGDVTAQIFWLKN
RKPEVWRDKKETELSGGVNLHNPFADLTTEELKKLVEDG
Download sequence
Identical sequences Q9K739
359075 WP_010899663.1.28103 gi|15616096|ref|NP_244401.1| 272558.BH3534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]