SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272560.BPSL1202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272560.BPSL1202
Domain Number - Region: 418-487
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0255
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272560.BPSL1202
Sequence length 515
Comment (Burkholderia pseudomallei K96243)
Sequence
MKNLRASFSTFPRDFVAGTVVFLVALPLCLGIANASGVEPFAGLVSGIVGGLVVAVLSGS
PLSVSGPAAGLVVIVVDGIAQLGSFQAFLLAVLLSGVIQFGFGLLKAGRFAAYVPSPVIK
GMLAAIGILLIVKQVPFALGLSGDGDAPGHAVFASSAIALASLALLAVWETRAMRRFAFV
RLVPAPLAVVILGIGATVLLGFVSPSFAPPAEHRVALPELASFAALGEALKTVDLGPNFA
YLLSPDVWRIAITIAVVASLETLLSLEAVEQIDPKRRPSQPNRELKAQGVGNLVAGAIGG
LPITSVIVRSSVNVNAGAQSRMSAIVHGVMLVVSVFALTWLLNLIPLASLAAILIHTGFK
LAKPALFTSVAKQGPGAFLPFAVTIAGVLAIDLLAGIALGLACSVFAVACANLRSPATLA
QHDDHYLLSFRKDVSFLGKVQIKQYLAQIPDRAVVIIDATRADYIDHDVREMIDAFVAEA
PRREITVDYRRQVQHVRGAGLRWFFRNPAAQQAPQ
Download sequence
Identical sequences A0A095GMC1 A0A0E1UPY1 A0A0E1W3R9 A0A2K3G849 A3NT95 C4KU57 Q3JUB8 Q63VP2
gi|237811572|ref|YP_002896023.1| gi|76810160|ref|YP_332835.1| gi|403517994|ref|YP_006652127.1| WP_004526456.1.100195 WP_004526456.1.101783 WP_004526456.1.10553 WP_004526456.1.10633 WP_004526456.1.10907 WP_004526456.1.11404 WP_004526456.1.11998 WP_004526456.1.12731 WP_004526456.1.12856 WP_004526456.1.13520 WP_004526456.1.13603 WP_004526456.1.13639 WP_004526456.1.1465 WP_004526456.1.16249 WP_004526456.1.16540 WP_004526456.1.16561 WP_004526456.1.16689 WP_004526456.1.17067 WP_004526456.1.17748 WP_004526456.1.18396 WP_004526456.1.18405 WP_004526456.1.18631 WP_004526456.1.18744 WP_004526456.1.18906 WP_004526456.1.19486 WP_004526456.1.20954 WP_004526456.1.21291 WP_004526456.1.21809 WP_004526456.1.21907 WP_004526456.1.22299 WP_004526456.1.2261 WP_004526456.1.23009 WP_004526456.1.23086 WP_004526456.1.23104 WP_004526456.1.23131 WP_004526456.1.24134 WP_004526456.1.24372 WP_004526456.1.24454 WP_004526456.1.25102 WP_004526456.1.26535 WP_004526456.1.26633 WP_004526456.1.26645 WP_004526456.1.27069 WP_004526456.1.27420 WP_004526456.1.2767 WP_004526456.1.28066 WP_004526456.1.28187 WP_004526456.1.29335 WP_004526456.1.29520 WP_004526456.1.29853 WP_004526456.1.29878 WP_004526456.1.29887 WP_004526456.1.30311 WP_004526456.1.31343 WP_004526456.1.33157 WP_004526456.1.33158 WP_004526456.1.35227 WP_004526456.1.35825 WP_004526456.1.36527 WP_004526456.1.36666 WP_004526456.1.37373 WP_004526456.1.37519 WP_004526456.1.37627 WP_004526456.1.37690 WP_004526456.1.37934 WP_004526456.1.37959 WP_004526456.1.38442 WP_004526456.1.38490 WP_004526456.1.3872 WP_004526456.1.39162 WP_004526456.1.39179 WP_004526456.1.3947 WP_004526456.1.39757 WP_004526456.1.40235 WP_004526456.1.40390 WP_004526456.1.42408 WP_004526456.1.42492 WP_004526456.1.42800 WP_004526456.1.43136 WP_004526456.1.43156 WP_004526456.1.43542 WP_004526456.1.43581 WP_004526456.1.43678 WP_004526456.1.43786 WP_004526456.1.44179 WP_004526456.1.44352 WP_004526456.1.44824 WP_004526456.1.46757 WP_004526456.1.4693 WP_004526456.1.47564 WP_004526456.1.48165 WP_004526456.1.48464 WP_004526456.1.49026 WP_004526456.1.50336 WP_004526456.1.50636 WP_004526456.1.50839 WP_004526456.1.51666 WP_004526456.1.51874 WP_004526456.1.51891 WP_004526456.1.52229 WP_004526456.1.52365 WP_004526456.1.52643 WP_004526456.1.5292 WP_004526456.1.53048 WP_004526456.1.53578 WP_004526456.1.54016 WP_004526456.1.54369 WP_004526456.1.55974 WP_004526456.1.5608 WP_004526456.1.56993 WP_004526456.1.57247 WP_004526456.1.58355 WP_004526456.1.58405 WP_004526456.1.5883 WP_004526456.1.59103 WP_004526456.1.59255 WP_004526456.1.59422 WP_004526456.1.59519 WP_004526456.1.59536 WP_004526456.1.59549 WP_004526456.1.60398 WP_004526456.1.60810 WP_004526456.1.61084 WP_004526456.1.61455 WP_004526456.1.62183 WP_004526456.1.63379 WP_004526456.1.63719 WP_004526456.1.64166 WP_004526456.1.64204 WP_004526456.1.64892 WP_004526456.1.65994 WP_004526456.1.67182 WP_004526456.1.67229 WP_004526456.1.6765 WP_004526456.1.67860 WP_004526456.1.68886 WP_004526456.1.68922 WP_004526456.1.69094 WP_004526456.1.69918 WP_004526456.1.70278 WP_004526456.1.70280 WP_004526456.1.71901 WP_004526456.1.72015 WP_004526456.1.72817 WP_004526456.1.73317 WP_004526456.1.73521 WP_004526456.1.73906 WP_004526456.1.74425 WP_004526456.1.7450 WP_004526456.1.75001 WP_004526456.1.75276 WP_004526456.1.75711 WP_004526456.1.75883 WP_004526456.1.76142 WP_004526456.1.766 WP_004526456.1.77287 WP_004526456.1.77689 WP_004526456.1.78506 WP_004526456.1.78759 WP_004526456.1.78827 WP_004526456.1.79052 WP_004526456.1.79689 WP_004526456.1.80433 WP_004526456.1.81511 WP_004526456.1.81665 WP_004526456.1.82197 WP_004526456.1.82323 WP_004526456.1.82394 WP_004526456.1.82694 WP_004526456.1.82915 WP_004526456.1.82950 WP_004526456.1.83357 WP_004526456.1.83487 WP_004526456.1.83543 WP_004526456.1.83688 WP_004526456.1.8390 WP_004526456.1.84026 WP_004526456.1.84375 WP_004526456.1.84654 WP_004526456.1.85170 WP_004526456.1.85412 WP_004526456.1.86525 WP_004526456.1.86806 WP_004526456.1.87278 WP_004526456.1.87553 WP_004526456.1.88237 WP_004526456.1.88322 WP_004526456.1.88920 WP_004526456.1.8912 WP_004526456.1.89514 WP_004526456.1.90079 WP_004526456.1.9079 WP_004526456.1.91025 WP_004526456.1.91823 WP_004526456.1.92095 WP_004526456.1.93844 WP_004526456.1.94023 WP_004526456.1.94050 WP_004526456.1.94520 WP_004526456.1.95420 WP_004526456.1.98547 WP_004526456.1.98753 WP_004526456.1.99061 WP_004526456.1.99233 WP_004526456.1.99290 WP_004526456.1.9962 WP_004526456.1.99741 WP_004526456.1.9975 YP_107824.1.59693 gi|53718838|ref|YP_107824.1| gi|126454102|ref|YP_001065566.1| 272560.BPSL1202 320372.BURPS1710b_1425 357348.BURPS1106A_1287 536230.GBP346_A1303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]