SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272560.BPSL3145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272560.BPSL3145
Domain Number 1 Region: 10-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272560.BPSL3145
Sequence length 89
Comment (Burkholderia pseudomallei K96243)
Sequence
MSRFDSGATLTHASAKAALAQGLARIEAGATAVDCGALAQFDSSALAVLLAWQRAARARG
VTLDIENLPPKLASLAQAYGIDTLLSGRH
Download sequence
Identical sequences A0A069B5H8 A0A0E1TQC1 A0A0E1UH27 A0A0E1W6G6 A0A0F6GB64 A0A0F6LEV0 A0A0H2WLP1 A0A290YCF5 A0A2K3ER86 A0A2K3G1Q5 A0A2K3H7Y3 A0A2K3HSS9 A2S742 A3NEA5 A3P039 A8EMA0 B1HL85 C4AW00 C4KWQ1 Q63Q80
gi|124385669|ref|YP_001027761.1| WP_004199923.1.100104 WP_004199923.1.100195 WP_004199923.1.10047 WP_004199923.1.100583 WP_004199923.1.100720 WP_004199923.1.100825 WP_004199923.1.100900 WP_004199923.1.1010 WP_004199923.1.101060 WP_004199923.1.101307 WP_004199923.1.101381 WP_004199923.1.101559 WP_004199923.1.101588 WP_004199923.1.101783 WP_004199923.1.102051 WP_004199923.1.10269 WP_004199923.1.10290 WP_004199923.1.10359 WP_004199923.1.10553 WP_004199923.1.10633 WP_004199923.1.10746 WP_004199923.1.10907 WP_004199923.1.1098 WP_004199923.1.11046 WP_004199923.1.11072 WP_004199923.1.11160 WP_004199923.1.11268 WP_004199923.1.11404 WP_004199923.1.11747 WP_004199923.1.11825 WP_004199923.1.11893 WP_004199923.1.11996 WP_004199923.1.11998 WP_004199923.1.1266 WP_004199923.1.12731 WP_004199923.1.12793 WP_004199923.1.12856 WP_004199923.1.12860 WP_004199923.1.13198 WP_004199923.1.13309 WP_004199923.1.13504 WP_004199923.1.13520 WP_004199923.1.13597 WP_004199923.1.13603 WP_004199923.1.13639 WP_004199923.1.13950 WP_004199923.1.14356 WP_004199923.1.14557 WP_004199923.1.1465 WP_004199923.1.14660 WP_004199923.1.15170 WP_004199923.1.15364 WP_004199923.1.15525 WP_004199923.1.15673 WP_004199923.1.15696 WP_004199923.1.16090 WP_004199923.1.16249 WP_004199923.1.16358 WP_004199923.1.16540 WP_004199923.1.16561 WP_004199923.1.16625 WP_004199923.1.16680 WP_004199923.1.16689 WP_004199923.1.16749 WP_004199923.1.17067 WP_004199923.1.17068 WP_004199923.1.17278 WP_004199923.1.17473 WP_004199923.1.17748 WP_004199923.1.17786 WP_004199923.1.18058 WP_004199923.1.18396 WP_004199923.1.18405 WP_004199923.1.18471 WP_004199923.1.18631 WP_004199923.1.18669 WP_004199923.1.18704 WP_004199923.1.18744 WP_004199923.1.18868 WP_004199923.1.18906 WP_004199923.1.19401 WP_004199923.1.19486 WP_004199923.1.19540 WP_004199923.1.19629 WP_004199923.1.1976 WP_004199923.1.19815 WP_004199923.1.19842 WP_004199923.1.19854 WP_004199923.1.20021 WP_004199923.1.20246 WP_004199923.1.20501 WP_004199923.1.20520 WP_004199923.1.20531 WP_004199923.1.20673 WP_004199923.1.20954 WP_004199923.1.21147 WP_004199923.1.21205 WP_004199923.1.21291 WP_004199923.1.21304 WP_004199923.1.21409 WP_004199923.1.21461 WP_004199923.1.21653 WP_004199923.1.21809 WP_004199923.1.21907 WP_004199923.1.22046 WP_004199923.1.22299 WP_004199923.1.22308 WP_004199923.1.22329 WP_004199923.1.2261 WP_004199923.1.23009 WP_004199923.1.23086 WP_004199923.1.23104 WP_004199923.1.23131 WP_004199923.1.2317 WP_004199923.1.23385 WP_004199923.1.23743 WP_004199923.1.23852 WP_004199923.1.23994 WP_004199923.1.24020 WP_004199923.1.2404 WP_004199923.1.24134 WP_004199923.1.24314 WP_004199923.1.24372 WP_004199923.1.24454 WP_004199923.1.24513 WP_004199923.1.2462 WP_004199923.1.24701 WP_004199923.1.25068 WP_004199923.1.25102 WP_004199923.1.25138 WP_004199923.1.25412 WP_004199923.1.25628 WP_004199923.1.25728 WP_004199923.1.259 WP_004199923.1.26054 WP_004199923.1.26445 WP_004199923.1.26502 WP_004199923.1.26535 WP_004199923.1.26565 WP_004199923.1.26633 WP_004199923.1.26645 WP_004199923.1.267 WP_004199923.1.26838 WP_004199923.1.26849 WP_004199923.1.27064 WP_004199923.1.27069 WP_004199923.1.27363 WP_004199923.1.27390 WP_004199923.1.27399 WP_004199923.1.27441 WP_004199923.1.27597 WP_004199923.1.2767 WP_004199923.1.27810 WP_004199923.1.27909 WP_004199923.1.28018 WP_004199923.1.28066 WP_004199923.1.28187 WP_004199923.1.28453 WP_004199923.1.28594 WP_004199923.1.28619 WP_004199923.1.28632 WP_004199923.1.29148 WP_004199923.1.29161 WP_004199923.1.29178 WP_004199923.1.29335 WP_004199923.1.29405 WP_004199923.1.29508 WP_004199923.1.29520 WP_004199923.1.29547 WP_004199923.1.29658 WP_004199923.1.29853 WP_004199923.1.29878 WP_004199923.1.29887 WP_004199923.1.29899 WP_004199923.1.29948 WP_004199923.1.30311 WP_004199923.1.30382 WP_004199923.1.3041 WP_004199923.1.3069 WP_004199923.1.30729 WP_004199923.1.30937 WP_004199923.1.30966 WP_004199923.1.31343 WP_004199923.1.31723 WP_004199923.1.31831 WP_004199923.1.32174 WP_004199923.1.32182 WP_004199923.1.32221 WP_004199923.1.324 WP_004199923.1.32581 WP_004199923.1.3273 WP_004199923.1.32951 WP_004199923.1.33077 WP_004199923.1.33087 WP_004199923.1.33157 WP_004199923.1.33158 WP_004199923.1.33165 WP_004199923.1.332 WP_004199923.1.33366 WP_004199923.1.33419 WP_004199923.1.33493 WP_004199923.1.33543 WP_004199923.1.33573 WP_004199923.1.33779 WP_004199923.1.34230 WP_004199923.1.34333 WP_004199923.1.34393 WP_004199923.1.34564 WP_004199923.1.34747 WP_004199923.1.35025 WP_004199923.1.35052 WP_004199923.1.35090 WP_004199923.1.35227 WP_004199923.1.35249 WP_004199923.1.35474 WP_004199923.1.35485 WP_004199923.1.35491 WP_004199923.1.35757 WP_004199923.1.35825 WP_004199923.1.35878 WP_004199923.1.36106 WP_004199923.1.36174 WP_004199923.1.36259 WP_004199923.1.36527 WP_004199923.1.366 WP_004199923.1.36662 WP_004199923.1.36666 WP_004199923.1.36944 WP_004199923.1.37 WP_004199923.1.3706 WP_004199923.1.37373 WP_004199923.1.37428 WP_004199923.1.37446 WP_004199923.1.37517 WP_004199923.1.37519 WP_004199923.1.37535 WP_004199923.1.37581 WP_004199923.1.37622 WP_004199923.1.37627 WP_004199923.1.37690 WP_004199923.1.37702 WP_004199923.1.37725 WP_004199923.1.37806 WP_004199923.1.37934 WP_004199923.1.37959 WP_004199923.1.37994 WP_004199923.1.38115 WP_004199923.1.38442 WP_004199923.1.38490 WP_004199923.1.38683 WP_004199923.1.3872 WP_004199923.1.38810 WP_004199923.1.38946 WP_004199923.1.39078 WP_004199923.1.39162 WP_004199923.1.39179 WP_004199923.1.3947 WP_004199923.1.39595 WP_004199923.1.39757 WP_004199923.1.39898 WP_004199923.1.40021 WP_004199923.1.40045 WP_004199923.1.40191 WP_004199923.1.40235 WP_004199923.1.40275 WP_004199923.1.40388 WP_004199923.1.40390 WP_004199923.1.40426 WP_004199923.1.40448 WP_004199923.1.4077 WP_004199923.1.41477 WP_004199923.1.41588 WP_004199923.1.41945 WP_004199923.1.42408 WP_004199923.1.42492 WP_004199923.1.42496 WP_004199923.1.42800 WP_004199923.1.43136 WP_004199923.1.43156 WP_004199923.1.43373 WP_004199923.1.43542 WP_004199923.1.43581 WP_004199923.1.43587 WP_004199923.1.43678 WP_004199923.1.43727 WP_004199923.1.43786 WP_004199923.1.43899 WP_004199923.1.44179 WP_004199923.1.44234 WP_004199923.1.44352 WP_004199923.1.44414 WP_004199923.1.44540 WP_004199923.1.44824 WP_004199923.1.45284 WP_004199923.1.45348 WP_004199923.1.45356 WP_004199923.1.45537 WP_004199923.1.45715 WP_004199923.1.45890 WP_004199923.1.4631 WP_004199923.1.46575 WP_004199923.1.46757 WP_004199923.1.46829 WP_004199923.1.4693 WP_004199923.1.46969 WP_004199923.1.47086 WP_004199923.1.47149 WP_004199923.1.4718 WP_004199923.1.47564 WP_004199923.1.48093 WP_004199923.1.4810 WP_004199923.1.48165 WP_004199923.1.48313 WP_004199923.1.48464 WP_004199923.1.49026 WP_004199923.1.49717 WP_004199923.1.49872 WP_004199923.1.50174 WP_004199923.1.50320 WP_004199923.1.50336 WP_004199923.1.50401 WP_004199923.1.50636 WP_004199923.1.50788 WP_004199923.1.50839 WP_004199923.1.5105 WP_004199923.1.51606 WP_004199923.1.51666 WP_004199923.1.5173 WP_004199923.1.5182 WP_004199923.1.51874 WP_004199923.1.51891 WP_004199923.1.51902 WP_004199923.1.52229 WP_004199923.1.52365 WP_004199923.1.52407 WP_004199923.1.52451 WP_004199923.1.52521 WP_004199923.1.52547 WP_004199923.1.52643 WP_004199923.1.52655 WP_004199923.1.52731 WP_004199923.1.52760 WP_004199923.1.52882 WP_004199923.1.5292 WP_004199923.1.53034 WP_004199923.1.53048 WP_004199923.1.53103 WP_004199923.1.53282 WP_004199923.1.5338 WP_004199923.1.53386 WP_004199923.1.53506 WP_004199923.1.53578 WP_004199923.1.53977 WP_004199923.1.54016 WP_004199923.1.5413 WP_004199923.1.54312 WP_004199923.1.54369 WP_004199923.1.54804 WP_004199923.1.54859 WP_004199923.1.54892 WP_004199923.1.55038 WP_004199923.1.55415 WP_004199923.1.55974 WP_004199923.1.55996 WP_004199923.1.5608 WP_004199923.1.56126 WP_004199923.1.56248 WP_004199923.1.5641 WP_004199923.1.56451 WP_004199923.1.56458 WP_004199923.1.56591 WP_004199923.1.56744 WP_004199923.1.56949 WP_004199923.1.56993 WP_004199923.1.57046 WP_004199923.1.57096 WP_004199923.1.57247 WP_004199923.1.5734 WP_004199923.1.57341 WP_004199923.1.57679 WP_004199923.1.5776 WP_004199923.1.58003 WP_004199923.1.58105 WP_004199923.1.58190 WP_004199923.1.58355 WP_004199923.1.58390 WP_004199923.1.58405 WP_004199923.1.58509 WP_004199923.1.58639 WP_004199923.1.58758 WP_004199923.1.5883 WP_004199923.1.59103 WP_004199923.1.59200 WP_004199923.1.59255 WP_004199923.1.59422 WP_004199923.1.59496 WP_004199923.1.59519 WP_004199923.1.59536 WP_004199923.1.59549 WP_004199923.1.59747 WP_004199923.1.60398 WP_004199923.1.60769 WP_004199923.1.60810 WP_004199923.1.60833 WP_004199923.1.60836 WP_004199923.1.60969 WP_004199923.1.61084 WP_004199923.1.61202 WP_004199923.1.61455 WP_004199923.1.61723 WP_004199923.1.61854 WP_004199923.1.6186 WP_004199923.1.61900 WP_004199923.1.62103 WP_004199923.1.62183 WP_004199923.1.62774 WP_004199923.1.63097 WP_004199923.1.63261 WP_004199923.1.63361 WP_004199923.1.63379 WP_004199923.1.63505 WP_004199923.1.63661 WP_004199923.1.63719 WP_004199923.1.63942 WP_004199923.1.64068 WP_004199923.1.64096 WP_004199923.1.64166 WP_004199923.1.64204 WP_004199923.1.64364 WP_004199923.1.64383 WP_004199923.1.64542 WP_004199923.1.64683 WP_004199923.1.64892 WP_004199923.1.65093 WP_004199923.1.65270 WP_004199923.1.65468 WP_004199923.1.65832 WP_004199923.1.65994 WP_004199923.1.66257 WP_004199923.1.66380 WP_004199923.1.66465 WP_004199923.1.67013 WP_004199923.1.67117 WP_004199923.1.67182 WP_004199923.1.67229 WP_004199923.1.67393 WP_004199923.1.67559 WP_004199923.1.6765 WP_004199923.1.67860 WP_004199923.1.67914 WP_004199923.1.67978 WP_004199923.1.6835 WP_004199923.1.68353 WP_004199923.1.68515 WP_004199923.1.68664 WP_004199923.1.68886 WP_004199923.1.68922 WP_004199923.1.69022 WP_004199923.1.69081 WP_004199923.1.69094 WP_004199923.1.69106 WP_004199923.1.69169 WP_004199923.1.69217 WP_004199923.1.69337 WP_004199923.1.69354 WP_004199923.1.69508 WP_004199923.1.69770 WP_004199923.1.69918 WP_004199923.1.70016 WP_004199923.1.7006 WP_004199923.1.70066 WP_004199923.1.70096 WP_004199923.1.70278 WP_004199923.1.70280 WP_004199923.1.70735 WP_004199923.1.71392 WP_004199923.1.71444 WP_004199923.1.71564 WP_004199923.1.71901 WP_004199923.1.72015 WP_004199923.1.72083 WP_004199923.1.72545 WP_004199923.1.72817 WP_004199923.1.73317 WP_004199923.1.73418 WP_004199923.1.73521 WP_004199923.1.73576 WP_004199923.1.73906 WP_004199923.1.73974 WP_004199923.1.74177 WP_004199923.1.74425 WP_004199923.1.7450 WP_004199923.1.74569 WP_004199923.1.74675 WP_004199923.1.74690 WP_004199923.1.75001 WP_004199923.1.75027 WP_004199923.1.75075 WP_004199923.1.75276 WP_004199923.1.75519 WP_004199923.1.75677 WP_004199923.1.75708 WP_004199923.1.75711 WP_004199923.1.75776 WP_004199923.1.75861 WP_004199923.1.75883 WP_004199923.1.75913 WP_004199923.1.75937 WP_004199923.1.76142 WP_004199923.1.76290 WP_004199923.1.76432 WP_004199923.1.76522 WP_004199923.1.76575 WP_004199923.1.766 WP_004199923.1.7703 WP_004199923.1.77249 WP_004199923.1.77287 WP_004199923.1.77319 WP_004199923.1.77689 WP_004199923.1.77788 WP_004199923.1.77845 WP_004199923.1.78029 WP_004199923.1.78278 WP_004199923.1.78506 WP_004199923.1.78557 WP_004199923.1.78628 WP_004199923.1.78759 WP_004199923.1.78807 WP_004199923.1.78827 WP_004199923.1.79052 WP_004199923.1.79360 WP_004199923.1.795 WP_004199923.1.79653 WP_004199923.1.79689 WP_004199923.1.79710 WP_004199923.1.79725 WP_004199923.1.79782 WP_004199923.1.80098 WP_004199923.1.80302 WP_004199923.1.80395 WP_004199923.1.80433 WP_004199923.1.80614 WP_004199923.1.80923 WP_004199923.1.81042 WP_004199923.1.8126 WP_004199923.1.81479 WP_004199923.1.81511 WP_004199923.1.81543 WP_004199923.1.81665 WP_004199923.1.82197 WP_004199923.1.82283 WP_004199923.1.82323 WP_004199923.1.82394 WP_004199923.1.82506 WP_004199923.1.82575 WP_004199923.1.82694 WP_004199923.1.82727 WP_004199923.1.82915 WP_004199923.1.82950 WP_004199923.1.83080 WP_004199923.1.83357 WP_004199923.1.8341 WP_004199923.1.83487 WP_004199923.1.83543 WP_004199923.1.83567 WP_004199923.1.83609 WP_004199923.1.83688 WP_004199923.1.8388 WP_004199923.1.8390 WP_004199923.1.8395 WP_004199923.1.83967 WP_004199923.1.84002 WP_004199923.1.84026 WP_004199923.1.84063 WP_004199923.1.84181 WP_004199923.1.84375 WP_004199923.1.84379 WP_004199923.1.84480 WP_004199923.1.84654 WP_004199923.1.85170 WP_004199923.1.85412 WP_004199923.1.85443 WP_004199923.1.85467 WP_004199923.1.85490 WP_004199923.1.85565 WP_004199923.1.85584 WP_004199923.1.856 WP_004199923.1.85641 WP_004199923.1.85645 WP_004199923.1.85774 WP_004199923.1.8585 WP_004199923.1.8629 WP_004199923.1.86295 WP_004199923.1.86438 WP_004199923.1.86525 WP_004199923.1.86806 WP_004199923.1.86872 WP_004199923.1.87114 WP_004199923.1.87278 WP_004199923.1.87324 WP_004199923.1.87553 WP_004199923.1.87652 WP_004199923.1.87759 WP_004199923.1.87811 WP_004199923.1.88003 WP_004199923.1.88117 WP_004199923.1.88168 WP_004199923.1.88237 WP_004199923.1.88322 WP_004199923.1.88369 WP_004199923.1.88411 WP_004199923.1.88666 WP_004199923.1.88682 WP_004199923.1.88764 WP_004199923.1.88920 WP_004199923.1.8912 WP_004199923.1.89240 WP_004199923.1.89435 WP_004199923.1.89514 WP_004199923.1.89782 WP_004199923.1.90079 WP_004199923.1.90471 WP_004199923.1.9079 WP_004199923.1.90934 WP_004199923.1.91025 WP_004199923.1.91142 WP_004199923.1.91198 WP_004199923.1.91700 WP_004199923.1.91709 WP_004199923.1.91763 WP_004199923.1.91823 WP_004199923.1.92095 WP_004199923.1.9236 WP_004199923.1.92367 WP_004199923.1.92406 WP_004199923.1.92430 WP_004199923.1.92493 WP_004199923.1.92507 WP_004199923.1.9280 WP_004199923.1.9281 WP_004199923.1.92904 WP_004199923.1.93844 WP_004199923.1.93845 WP_004199923.1.94023 WP_004199923.1.94050 WP_004199923.1.94117 WP_004199923.1.94121 WP_004199923.1.94286 WP_004199923.1.94403 WP_004199923.1.94498 WP_004199923.1.94520 WP_004199923.1.9479 WP_004199923.1.94901 WP_004199923.1.94926 WP_004199923.1.95054 WP_004199923.1.95300 WP_004199923.1.95339 WP_004199923.1.9537 WP_004199923.1.95420 WP_004199923.1.95587 WP_004199923.1.95644 WP_004199923.1.95672 WP_004199923.1.95938 WP_004199923.1.95952 WP_004199923.1.96381 WP_004199923.1.96660 WP_004199923.1.97058 WP_004199923.1.97112 WP_004199923.1.97989 WP_004199923.1.98066 WP_004199923.1.98218 WP_004199923.1.98316 WP_004199923.1.98491 WP_004199923.1.98547 WP_004199923.1.98688 WP_004199923.1.98713 WP_004199923.1.98753 WP_004199923.1.98768 WP_004199923.1.98944 WP_004199923.1.99061 WP_004199923.1.99069 WP_004199923.1.99160 WP_004199923.1.99233 WP_004199923.1.99290 WP_004199923.1.9962 WP_004199923.1.99629 WP_004199923.1.99741 WP_004199923.1.9975 WP_004199923.1.9983 WP_004199923.1.99890 WP_004199923.1.99919 YP_104242.1.87047 YP_109738.1.59693 gi|126450722|ref|YP_001082292.1| gi|53726083|ref|YP_104242.1| gi|53720752|ref|YP_109738.1| gi|121598503|ref|YP_994516.1| gi|126440072|ref|YP_001060676.1| gi|126453492|ref|YP_001067960.1| gi|403520394|ref|YP_006654528.1| 243160.BMA2721 272560.BPSL3145 320373.BURPS668_3672 320388.BMASAVP1_A3233 320389.BMA10247_2771 357348.BURPS1106A_3730 412022.BMA10229_A1782 536230.GBP346_A3857 gi|237814072|ref|YP_002898523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]