SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272560.BPSS0615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272560.BPSS0615
Domain Number 1 Region: 48-234
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.73e-23
Family Biotin dependent carboxylase carboxyltransferase domain 0.048
Further Details:      
 
Domain Number 2 Region: 453-491
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000144
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272560.BPSS0615
Sequence length 504
Comment (Burkholderia pseudomallei K96243)
Sequence
MPRSSPRPPPARGKLPARLARAAVLIGLLLACAAAAAAAGAAAAARAPIVVIPVAGAIGP
ASADFVVRGLERAAREHAPLAIVQLDTPGGLDTSMRQIIKAIVASGVPVAAFVAPGGARA
ASAGTYIVYASHVAAMAPGTNLGAASPVQLGIGGQAPAGGRREPAGAPGAAGAGATDTES
IETRKALHDAAAYIRGLAQLRGRNAEWAERAVREAVSLPANDALAQHVVDLLANDPADLA
AKLDGRTIVTATGAHRLDTAQAPLETLEPDWRSRLLATIADPSVALVLVTLGMYGLFFEF
ANPGFVLPGVAGAISLLVGLFALQLLPISYAGLALVLLGIAFLIAETFLPTFGALGVGGI
VAFAIGALMLIDTDVPGYGVPWPVIASLAAAGAILVFGVSGFALRARRRPVVTGAEAIVG
SIGEVLDDGLVPDQPPQIGPSADPGAPLAPSAAGWARVHGERWRVASATPIAAGRRVRVT
GRNGLTLTVAPLYDNVVPPRGEPP
Download sequence
Identical sequences Q63MN5
272560.BPSS0615 gi|53721651|ref|YP_110636.1| WP_011205436.1.100825 WP_011205436.1.17786 WP_011205436.1.19629 WP_011205436.1.1976 WP_011205436.1.27363 WP_011205436.1.28594 WP_011205436.1.29948 WP_011205436.1.30311 WP_011205436.1.43727 WP_011205436.1.57096 WP_011205436.1.65832 WP_011205436.1.68886 WP_011205436.1.79725 WP_011205436.1.95672 YP_110636.1.59693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]