SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C1051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272562.CA_C1051
Domain Number - Region: 84-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000732
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C1051
Sequence length 146
Comment (Clostridium acetobutylicum)
Sequence
MNDYQKIWIIIAIFMVVIDFGTSGFLFVWFSAGAVVAIIAGLLGAPITVQIVLFAIISIA
LLSVGYPLSKKLLNRTVRKTPLMEEKYIGREVKAEADMEVGNSKLKVDGIYWTVKNVGEA
IKKGDCFIITGIQGNKLLIRKKGEIE
Download sequence
Identical sequences Q97K68
gi|337736269|ref|YP_004635716.1| GO.2534 gi|15894338|ref|NP_347687.1| 272562.CA_C1051 NP_347687.1.94244 WP_010964369.1.17575 WP_010964369.1.17905 WP_010964369.1.48544 WP_010964369.1.57811 WP_010964369.1.71350 WP_010964369.1.92914 gi|384457777|ref|YP_005670197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]