SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C1220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272562.CA_C1220
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00615
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C1220
Sequence length 84
Comment (Clostridium acetobutylicum)
Sequence
MHIKFITKKEHKVKLENYIGKPIIKKGTKDYPIGVITKATEHINDNGYITIEAEIWDKFI
DIKNKYLSNENYCSISLEFEGRLK
Download sequence
Identical sequences Q97JQ3
gi|337736438|ref|YP_004635885.1| 272562.CA_C1220 gi|15894503|ref|NP_347852.1| NP_347852.1.94244 WP_010964533.1.17575 WP_010964533.1.17905 WP_010964533.1.48544 WP_010964533.1.57811 WP_010964533.1.71350 WP_010964533.1.92914 gi|384457945|ref|YP_005670365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]