SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C2308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_C2308
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.97e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C2308
Sequence length 111
Comment (Clostridium acetobutylicum)
Sequence
MNLDFKDINGKLVVSIIGELDHHSSEEIRNKIDDHIKFKGYKNVILDFSNVTFMDSSGIG
VVIGRYKKLNSSGGSICVVGPKESVRRIFELSGMLKIINIYGSLDKAVTSI
Download sequence
Identical sequences Q97GQ8
gi|15895575|ref|NP_348924.1| NP_348924.1.94244 WP_010965605.1.17575 WP_010965605.1.17905 WP_010965605.1.48544 WP_010965605.1.57811 WP_010965605.1.63117 WP_010965605.1.71350 WP_010965605.1.92914 gi|337737525|ref|YP_004636972.1| 272562.CA_C2308 gi|384459035|ref|YP_005671455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]