SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272564.Dhaf_1186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272564.Dhaf_1186
Domain Number - Region: 130-205
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00275
Family Voltage-gated potassium channels 0.0074
Further Details:      
 
Domain Number - Region: 48-139
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0549
Family MgtE membrane domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272564.Dhaf_1186
Sequence length 213
Comment (Desulfitobacterium hafniense DCB 2)
Sequence
MYGSIADYSSYADSYLSNYPRPSFLGHIKRTAPIPPQEEEERFEAKRAAHANVWLLVPAM
TGTVAYYLFTSIFRGIRQREEEDKAVAGKIGSVVYTGIVTAGLSAYIYSVLILADGHLMD
VYWPIAGAITVQLLYFAAVYTWLYRLDYSSFSAEVEDEPIEELLTFLYFSITNFATTGSS
VFPESITARLLVGLQVLFLVFSFTMGLVFFTNP
Download sequence
Identical sequences B8G129
272564.Dhaf_1186 gi|219667245|ref|YP_002457680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]