SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272568.GDI_2171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272568.GDI_2171
Domain Number 1 Region: 95-360
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.86e-83
Family D-glucarate dehydratase-like 0.0000783
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.18e-31
Family Enolase N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272568.GDI_2171
Sequence length 382
Comment (Gluconacetobacter diazotrophicus PAl 5 FAPERJ)
Sequence
MKITKLTTFQVPPRWLFLKIETDEGISGWGEPVVEGRADTVAAAVAELADYLVGKDPFRI
EDHWTVLYRGGFYRGGAVHMSAIAGIDQALWDIKGRAFGVPVHDLLGGRCRDRIRVYSWI
GGDRPADTAQAVRAVVDRGFTAIKMNATEELQYVDSHAKVDDVIARVAAIREEAGPYLGI
GVDFHGRVHKPMAKVLARELEPYDLMFIEEPVLSEHLEDLPEITKHTSIPIALGERLFSR
WDFKRVFEQGCVDIIQPDPSHAGGITETRKIAAMAEAYDVAVALHCPLGPIALAANLQLD
ALCYNAFIQEQSLGIHYNKTNDLLDYLVDPDVFAYRDGHVDIPTGPGLGIEINEDYVRAR
AAEGHRWRNRSGGIATRSFAEW
Download sequence
Identical sequences A9HL32
WP_012225986.1.42434 gi|162147955|ref|YP_001602416.1| 272568.GDI_2171 gi|162147955|ref|YP_001602416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]