SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272569.pNG7323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272569.pNG7323
Domain Number 1 Region: 264-392
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.04e-28
Family Potassium channel NAD-binding domain 0.00074
Further Details:      
 
Domain Number 2 Region: 144-280
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-18
Family Voltage-gated potassium channels 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272569.pNG7323
Sequence length 417
Comment (Haloarcula marismortui ATCC 43049)
Sequence
MLMANVPEDSSDRTLEDVFYPADRVPFVEWDELSGAKPTVVLTGTVALLAFVTGLSNLSQ
ASLALNGPLTAVVDLPLPFVRFGGVLFAFVLGIVTVGLQRRKQLAWRVAAVVLLGLVVLP
LTTFQPTDIPLLLLTLVTYPLLVRNRHRFDQSLDLSPIQIASLSAIFGVVLYGTVGAYGL
RGQFLELDSWGDAVYYVVVTIATVGYGDITPVTAEARWFSLSIILFGTGAFTVAVGALIG
PAIESRMATAFGVMTASELTLLEDHVVVLGYGDVTASLLEELGDETEVVVVTPDEETVAS
LQGEGVNLLTGDPTDEDVLRDARVGTASGVVVGSNDDARDVLAVIATKNVNPDIRTVAAA
TAEKHVEKFRAVGADEVINPRSIGGRLLGKSVLGRKSSEPLLDGIVADDGESGDTTE
Download sequence
Identical sequences Q5V634
gi|55376873|ref|YP_134724.1|NC_006395 272569.pNG7323 gi|55376873|ref|YP_134724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]