SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272569.rrnAC0687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272569.rrnAC0687
Domain Number 1 Region: 193-439
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.09e-74
Family D-glucarate dehydratase-like 0.000000572
Further Details:      
 
Domain Number 2 Region: 27-188
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.89e-54
Family Enolase N-terminal domain-like 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272569.rrnAC0687
Sequence length 448
Comment (Haloarcula marismortui ATCC 43049)
Sequence
MTWTPSAMGSSSGGRAATTAPQGVQAMRIEDVRTVPGLSGFFFDDQQAIKDGATQTGFAY
DGQPVTDGFDRIREAGEALIVEIELADGSIATGDCAAVQYSGAGGRDPLFRAEKYRPVVE
GAVADALRGQDATQFGANATMLEEMSPQRSGGDQLHTAVRYGVSQALLNAAAQARGVTPT
DVLADTYDTEPATSPVPVFGQSGDERRINAEKMLIKGVPVLPHGLFNSVEKVGENGEGLR
DYLAWLSDRATALGPEPYSPRFHVDVYGILGKVFGPPYDRTEVTDYFETLREAAAPYPLQ
VEGPMDAGGRQAQITEMAELREGLADAGVDVDIVADEWCNTFEDVQAFVDAEAADLVQIK
TPDLGGIQRSAEAVLYCDGTDTRAYVGGTCNETVTSARACAHVALATDAAQVLAKPGMGF
DEGFMVVTNEMRRALARRDATQEVPADD
Download sequence
Identical sequences gi|55377543|ref|YP_135393.1| 272569.rrnAC0687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]