SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272569.rrnAC1802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272569.rrnAC1802
Domain Number - Region: 97-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.034
Family NfeD domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272569.rrnAC1802
Sequence length 198
Comment (Haloarcula marismortui ATCC 43049)
Sequence
MVNPLATVAPLQAEPLLGMSLSILLFLAGAGLIVGEALAPGTHFFVLGVALLTAGLVGLF
IPASLGILAPLILTVVVLATTAVTLWGYRKLDFAAPGRGQTLSSDSLTGQFGTVTERVTR
SDGEVKLEDGGFNPYYQARSSGDPIEEGAEVIVIDPGGGNVLEVEAVESGADEIDRALER
DRNRSDADTEPERESERA
Download sequence
Identical sequences M0K521 M0KL91 Q5V1B1
272569.rrnAC1802 WP_004957882.1.69175 WP_004957882.1.84793 WP_004957882.1.89716 gi|55378548|ref|YP_136398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]