SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_00466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_00466
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000641
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  272620.KPN_00466
Domain Number - Region: 27-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00523
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_00466
Sequence length 152
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MIGMILTHPHLFWLSLGGLLLAAEMLGGSGYLLWSGVAGVVTGALTWLLPLSWEWQGTLF
AVLTLLAAWLWSKWLRKRVKTQRPADAQLNQRGQQLVGRRLTLDAPLVNGRGHVRVGDSS
WPVIADEDFAAGSKVEVIAVEGITLRIRPAVR
Download sequence
Identical sequences A0A0E1CIQ8 A0A0H3GP64 A0A0J2GD80 A0A1L5GI24 A0A2D3CTW8 A6T5P6 W8UZ64
gi|386033520|ref|YP_005953433.1| WP_004151325.1.100062 WP_004151325.1.100176 WP_004151325.1.100410 WP_004151325.1.100566 WP_004151325.1.100599 WP_004151325.1.100702 WP_004151325.1.100713 WP_004151325.1.100896 WP_004151325.1.100988 WP_004151325.1.10101 WP_004151325.1.101391 WP_004151325.1.101451 WP_004151325.1.101480 WP_004151325.1.101528 WP_004151325.1.101549 WP_004151325.1.101648 WP_004151325.1.101834 WP_004151325.1.101867 WP_004151325.1.101892 WP_004151325.1.10203 WP_004151325.1.102072 WP_004151325.1.10218 WP_004151325.1.10227 WP_004151325.1.10360 WP_004151325.1.10456 WP_004151325.1.10473 WP_004151325.1.10604 WP_004151325.1.1061 WP_004151325.1.10889 WP_004151325.1.10908 WP_004151325.1.11191 WP_004151325.1.11269 WP_004151325.1.11338 WP_004151325.1.11340 WP_004151325.1.11506 WP_004151325.1.11551 WP_004151325.1.11555 WP_004151325.1.11601 WP_004151325.1.11647 WP_004151325.1.11694 WP_004151325.1.11783 WP_004151325.1.11791 WP_004151325.1.11827 WP_004151325.1.1193 WP_004151325.1.11962 WP_004151325.1.11994 WP_004151325.1.12003 WP_004151325.1.12006 WP_004151325.1.12032 WP_004151325.1.12074 WP_004151325.1.12082 WP_004151325.1.12089 WP_004151325.1.12108 WP_004151325.1.1226 WP_004151325.1.12281 WP_004151325.1.12418 WP_004151325.1.1245 WP_004151325.1.12462 WP_004151325.1.12481 WP_004151325.1.12602 WP_004151325.1.12689 WP_004151325.1.12712 WP_004151325.1.12760 WP_004151325.1.1298 WP_004151325.1.13030 WP_004151325.1.13044 WP_004151325.1.13171 WP_004151325.1.13202 WP_004151325.1.13373 WP_004151325.1.13483 WP_004151325.1.13524 WP_004151325.1.13594 WP_004151325.1.13646 WP_004151325.1.13690 WP_004151325.1.13717 WP_004151325.1.13783 WP_004151325.1.13922 WP_004151325.1.14068 WP_004151325.1.14118 WP_004151325.1.14138 WP_004151325.1.14232 WP_004151325.1.14241 WP_004151325.1.14268 WP_004151325.1.14438 WP_004151325.1.14594 WP_004151325.1.14603 WP_004151325.1.14653 WP_004151325.1.14732 WP_004151325.1.14735 WP_004151325.1.14851 WP_004151325.1.14920 WP_004151325.1.14941 WP_004151325.1.14986 WP_004151325.1.14996 WP_004151325.1.15063 WP_004151325.1.15082 WP_004151325.1.15194 WP_004151325.1.15279 WP_004151325.1.1532 WP_004151325.1.15361 WP_004151325.1.15574 WP_004151325.1.15610 WP_004151325.1.15629 WP_004151325.1.15715 WP_004151325.1.1572 WP_004151325.1.15806 WP_004151325.1.15832 WP_004151325.1.15839 WP_004151325.1.1596 WP_004151325.1.16128 WP_004151325.1.16196 WP_004151325.1.1631 WP_004151325.1.16348 WP_004151325.1.16505 WP_004151325.1.16515 WP_004151325.1.16536 WP_004151325.1.16758 WP_004151325.1.16830 WP_004151325.1.17053 WP_004151325.1.17211 WP_004151325.1.17236 WP_004151325.1.17342 WP_004151325.1.17508 WP_004151325.1.17587 WP_004151325.1.17736 WP_004151325.1.17768 WP_004151325.1.1782 WP_004151325.1.17926 WP_004151325.1.18148 WP_004151325.1.18150 WP_004151325.1.18217 WP_004151325.1.18227 WP_004151325.1.18284 WP_004151325.1.18296 WP_004151325.1.18351 WP_004151325.1.18431 WP_004151325.1.18434 WP_004151325.1.18552 WP_004151325.1.18664 WP_004151325.1.18736 WP_004151325.1.18788 WP_004151325.1.18832 WP_004151325.1.18932 WP_004151325.1.18964 WP_004151325.1.18981 WP_004151325.1.19058 WP_004151325.1.19209 WP_004151325.1.19278 WP_004151325.1.19354 WP_004151325.1.19421 WP_004151325.1.19476 WP_004151325.1.19664 WP_004151325.1.19786 WP_004151325.1.19885 WP_004151325.1.19911 WP_004151325.1.2000 WP_004151325.1.20179 WP_004151325.1.20217 WP_004151325.1.20375 WP_004151325.1.2044 WP_004151325.1.2045 WP_004151325.1.20472 WP_004151325.1.205 WP_004151325.1.20621 WP_004151325.1.20639 WP_004151325.1.2068 WP_004151325.1.20750 WP_004151325.1.20823 WP_004151325.1.20902 WP_004151325.1.21023 WP_004151325.1.21323 WP_004151325.1.21587 WP_004151325.1.21791 WP_004151325.1.21831 WP_004151325.1.21851 WP_004151325.1.21854 WP_004151325.1.21892 WP_004151325.1.21913 WP_004151325.1.22101 WP_004151325.1.22129 WP_004151325.1.22191 WP_004151325.1.22398 WP_004151325.1.2243 WP_004151325.1.22447 WP_004151325.1.2249 WP_004151325.1.2252 WP_004151325.1.22607 WP_004151325.1.22910 WP_004151325.1.22929 WP_004151325.1.23071 WP_004151325.1.23144 WP_004151325.1.23454 WP_004151325.1.2346 WP_004151325.1.2350 WP_004151325.1.23543 WP_004151325.1.23560 WP_004151325.1.23564 WP_004151325.1.23614 WP_004151325.1.23672 WP_004151325.1.23673 WP_004151325.1.23868 WP_004151325.1.23877 WP_004151325.1.23921 WP_004151325.1.23981 WP_004151325.1.23982 WP_004151325.1.24027 WP_004151325.1.24036 WP_004151325.1.24074 WP_004151325.1.2414 WP_004151325.1.24166 WP_004151325.1.24211 WP_004151325.1.24267 WP_004151325.1.2432 WP_004151325.1.244 WP_004151325.1.24566 WP_004151325.1.24587 WP_004151325.1.24635 WP_004151325.1.24801 WP_004151325.1.24911 WP_004151325.1.24919 WP_004151325.1.24951 WP_004151325.1.25122 WP_004151325.1.2513 WP_004151325.1.25198 WP_004151325.1.25254 WP_004151325.1.25391 WP_004151325.1.25429 WP_004151325.1.25559 WP_004151325.1.25938 WP_004151325.1.25969 WP_004151325.1.25987 WP_004151325.1.26045 WP_004151325.1.26200 WP_004151325.1.26219 WP_004151325.1.26308 WP_004151325.1.26336 WP_004151325.1.26342 WP_004151325.1.26396 WP_004151325.1.26448 WP_004151325.1.26515 WP_004151325.1.26639 WP_004151325.1.26830 WP_004151325.1.27054 WP_004151325.1.27224 WP_004151325.1.27356 WP_004151325.1.27443 WP_004151325.1.27488 WP_004151325.1.27543 WP_004151325.1.27703 WP_004151325.1.27766 WP_004151325.1.27828 WP_004151325.1.27952 WP_004151325.1.2796 WP_004151325.1.28083 WP_004151325.1.28112 WP_004151325.1.28135 WP_004151325.1.28291 WP_004151325.1.2870 WP_004151325.1.28910 WP_004151325.1.28927 WP_004151325.1.28974 WP_004151325.1.29021 WP_004151325.1.29072 WP_004151325.1.29346 WP_004151325.1.29392 WP_004151325.1.29424 WP_004151325.1.29466 WP_004151325.1.29529 WP_004151325.1.29636 WP_004151325.1.29772 WP_004151325.1.2990 WP_004151325.1.29915 WP_004151325.1.30010 WP_004151325.1.30132 WP_004151325.1.30264 WP_004151325.1.30296 WP_004151325.1.30339 WP_004151325.1.30390 WP_004151325.1.30455 WP_004151325.1.30471 WP_004151325.1.30576 WP_004151325.1.30634 WP_004151325.1.30704 WP_004151325.1.30897 WP_004151325.1.30929 WP_004151325.1.3099 WP_004151325.1.313 WP_004151325.1.31374 WP_004151325.1.31536 WP_004151325.1.3164 WP_004151325.1.31890 WP_004151325.1.31938 WP_004151325.1.31948 WP_004151325.1.31992 WP_004151325.1.32057 WP_004151325.1.32211 WP_004151325.1.32212 WP_004151325.1.32315 WP_004151325.1.32336 WP_004151325.1.32369 WP_004151325.1.32371 WP_004151325.1.32788 WP_004151325.1.32809 WP_004151325.1.32827 WP_004151325.1.32849 WP_004151325.1.32854 WP_004151325.1.32857 WP_004151325.1.33041 WP_004151325.1.33136 WP_004151325.1.3317 WP_004151325.1.33435 WP_004151325.1.33481 WP_004151325.1.33544 WP_004151325.1.33704 WP_004151325.1.33755 WP_004151325.1.33831 WP_004151325.1.33889 WP_004151325.1.34113 WP_004151325.1.34311 WP_004151325.1.34316 WP_004151325.1.34390 WP_004151325.1.34439 WP_004151325.1.34636 WP_004151325.1.34678 WP_004151325.1.34696 WP_004151325.1.34706 WP_004151325.1.34885 WP_004151325.1.34955 WP_004151325.1.35033 WP_004151325.1.35568 WP_004151325.1.35626 WP_004151325.1.35699 WP_004151325.1.35731 WP_004151325.1.35793 WP_004151325.1.35814 WP_004151325.1.35850 WP_004151325.1.35863 WP_004151325.1.36018 WP_004151325.1.3605 WP_004151325.1.36092 WP_004151325.1.36099 WP_004151325.1.36130 WP_004151325.1.36237 WP_004151325.1.36306 WP_004151325.1.36383 WP_004151325.1.36388 WP_004151325.1.3644 WP_004151325.1.36451 WP_004151325.1.36849 WP_004151325.1.37066 WP_004151325.1.3716 WP_004151325.1.37171 WP_004151325.1.37177 WP_004151325.1.37235 WP_004151325.1.37279 WP_004151325.1.37361 WP_004151325.1.37438 WP_004151325.1.37565 WP_004151325.1.37681 WP_004151325.1.37829 WP_004151325.1.38008 WP_004151325.1.38179 WP_004151325.1.38231 WP_004151325.1.38236 WP_004151325.1.38269 WP_004151325.1.38433 WP_004151325.1.38448 WP_004151325.1.38464 WP_004151325.1.3862 WP_004151325.1.38705 WP_004151325.1.38737 WP_004151325.1.38912 WP_004151325.1.38921 WP_004151325.1.38970 WP_004151325.1.39101 WP_004151325.1.39169 WP_004151325.1.39439 WP_004151325.1.39498 WP_004151325.1.39698 WP_004151325.1.39815 WP_004151325.1.3982 WP_004151325.1.39878 WP_004151325.1.3992 WP_004151325.1.4 WP_004151325.1.40078 WP_004151325.1.40185 WP_004151325.1.40201 WP_004151325.1.40394 WP_004151325.1.40527 WP_004151325.1.40561 WP_004151325.1.40604 WP_004151325.1.40614 WP_004151325.1.40675 WP_004151325.1.4098 WP_004151325.1.41003 WP_004151325.1.41049 WP_004151325.1.41073 WP_004151325.1.41182 WP_004151325.1.41221 WP_004151325.1.41282 WP_004151325.1.41283 WP_004151325.1.41336 WP_004151325.1.414 WP_004151325.1.4154 WP_004151325.1.41630 WP_004151325.1.41669 WP_004151325.1.41702 WP_004151325.1.41765 WP_004151325.1.41833 WP_004151325.1.41924 WP_004151325.1.41928 WP_004151325.1.41930 WP_004151325.1.42079 WP_004151325.1.42280 WP_004151325.1.42297 WP_004151325.1.42306 WP_004151325.1.42338 WP_004151325.1.42464 WP_004151325.1.42518 WP_004151325.1.42578 WP_004151325.1.42583 WP_004151325.1.42629 WP_004151325.1.43010 WP_004151325.1.4312 WP_004151325.1.43214 WP_004151325.1.43231 WP_004151325.1.43233 WP_004151325.1.43386 WP_004151325.1.4346 WP_004151325.1.43492 WP_004151325.1.4351 WP_004151325.1.43538 WP_004151325.1.4359 WP_004151325.1.43601 WP_004151325.1.43611 WP_004151325.1.44325 WP_004151325.1.44368 WP_004151325.1.44418 WP_004151325.1.44567 WP_004151325.1.44896 WP_004151325.1.44946 WP_004151325.1.45107 WP_004151325.1.45191 WP_004151325.1.45258 WP_004151325.1.45380 WP_004151325.1.45443 WP_004151325.1.45445 WP_004151325.1.45482 WP_004151325.1.45519 WP_004151325.1.45520 WP_004151325.1.45592 WP_004151325.1.45644 WP_004151325.1.45910 WP_004151325.1.45970 WP_004151325.1.46 WP_004151325.1.46002 WP_004151325.1.46006 WP_004151325.1.46130 WP_004151325.1.46175 WP_004151325.1.46260 WP_004151325.1.46279 WP_004151325.1.46393 WP_004151325.1.46397 WP_004151325.1.46427 WP_004151325.1.46455 WP_004151325.1.4655 WP_004151325.1.46782 WP_004151325.1.46890 WP_004151325.1.4697 WP_004151325.1.47007 WP_004151325.1.47027 WP_004151325.1.47165 WP_004151325.1.47252 WP_004151325.1.47302 WP_004151325.1.47354 WP_004151325.1.47371 WP_004151325.1.47376 WP_004151325.1.47378 WP_004151325.1.47413 WP_004151325.1.47461 WP_004151325.1.47623 WP_004151325.1.47641 WP_004151325.1.47661 WP_004151325.1.47716 WP_004151325.1.47760 WP_004151325.1.4779 WP_004151325.1.47815 WP_004151325.1.4787 WP_004151325.1.47887 WP_004151325.1.47922 WP_004151325.1.47982 WP_004151325.1.48228 WP_004151325.1.48237 WP_004151325.1.48255 WP_004151325.1.48362 WP_004151325.1.48402 WP_004151325.1.48442 WP_004151325.1.48539 WP_004151325.1.48673 WP_004151325.1.48686 WP_004151325.1.48850 WP_004151325.1.48900 WP_004151325.1.48972 WP_004151325.1.48975 WP_004151325.1.49006 WP_004151325.1.49052 WP_004151325.1.49069 WP_004151325.1.49151 WP_004151325.1.49333 WP_004151325.1.49394 WP_004151325.1.49613 WP_004151325.1.49721 WP_004151325.1.49762 WP_004151325.1.49817 WP_004151325.1.49829 WP_004151325.1.49834 WP_004151325.1.49877 WP_004151325.1.50049 WP_004151325.1.50133 WP_004151325.1.50165 WP_004151325.1.5026 WP_004151325.1.50283 WP_004151325.1.50321 WP_004151325.1.50335 WP_004151325.1.50364 WP_004151325.1.50465 WP_004151325.1.5054 WP_004151325.1.5057 WP_004151325.1.50619 WP_004151325.1.50693 WP_004151325.1.50823 WP_004151325.1.50910 WP_004151325.1.51090 WP_004151325.1.51105 WP_004151325.1.51132 WP_004151325.1.51181 WP_004151325.1.51311 WP_004151325.1.51312 WP_004151325.1.51372 WP_004151325.1.51390 WP_004151325.1.5140 WP_004151325.1.51479 WP_004151325.1.51560 WP_004151325.1.51599 WP_004151325.1.51670 WP_004151325.1.51688 WP_004151325.1.51779 WP_004151325.1.51885 WP_004151325.1.51907 WP_004151325.1.51965 WP_004151325.1.51975 WP_004151325.1.52079 WP_004151325.1.52215 WP_004151325.1.52288 WP_004151325.1.52309 WP_004151325.1.52368 WP_004151325.1.52477 WP_004151325.1.52534 WP_004151325.1.52609 WP_004151325.1.52635 WP_004151325.1.52686 WP_004151325.1.52703 WP_004151325.1.52927 WP_004151325.1.52929 WP_004151325.1.52954 WP_004151325.1.53015 WP_004151325.1.53061 WP_004151325.1.53359 WP_004151325.1.53388 WP_004151325.1.53402 WP_004151325.1.53484 WP_004151325.1.53568 WP_004151325.1.53585 WP_004151325.1.53817 WP_004151325.1.53834 WP_004151325.1.53897 WP_004151325.1.53990 WP_004151325.1.54011 WP_004151325.1.5406 WP_004151325.1.54129 WP_004151325.1.54212 WP_004151325.1.54380 WP_004151325.1.54448 WP_004151325.1.54959 WP_004151325.1.55032 WP_004151325.1.55050 WP_004151325.1.551 WP_004151325.1.55188 WP_004151325.1.55228 WP_004151325.1.55351 WP_004151325.1.55364 WP_004151325.1.55382 WP_004151325.1.55455 WP_004151325.1.55515 WP_004151325.1.55580 WP_004151325.1.55801 WP_004151325.1.55863 WP_004151325.1.56017 WP_004151325.1.56125 WP_004151325.1.56195 WP_004151325.1.5622 WP_004151325.1.5634 WP_004151325.1.56484 WP_004151325.1.56551 WP_004151325.1.56604 WP_004151325.1.56897 WP_004151325.1.57112 WP_004151325.1.57365 WP_004151325.1.57455 WP_004151325.1.57497 WP_004151325.1.57618 WP_004151325.1.57643 WP_004151325.1.57662 WP_004151325.1.57877 WP_004151325.1.57914 WP_004151325.1.57940 WP_004151325.1.57993 WP_004151325.1.58091 WP_004151325.1.58118 WP_004151325.1.58224 WP_004151325.1.58307 WP_004151325.1.5831 WP_004151325.1.58399 WP_004151325.1.58466 WP_004151325.1.58579 WP_004151325.1.58685 WP_004151325.1.58752 WP_004151325.1.58771 WP_004151325.1.58873 WP_004151325.1.58890 WP_004151325.1.59015 WP_004151325.1.59115 WP_004151325.1.59222 WP_004151325.1.59485 WP_004151325.1.59557 WP_004151325.1.59600 WP_004151325.1.59705 WP_004151325.1.59708 WP_004151325.1.5975 WP_004151325.1.59840 WP_004151325.1.59873 WP_004151325.1.59972 WP_004151325.1.59996 WP_004151325.1.60038 WP_004151325.1.60074 WP_004151325.1.60266 WP_004151325.1.60336 WP_004151325.1.60416 WP_004151325.1.60511 WP_004151325.1.60534 WP_004151325.1.60587 WP_004151325.1.60611 WP_004151325.1.60745 WP_004151325.1.60861 WP_004151325.1.6089 WP_004151325.1.60905 WP_004151325.1.6099 WP_004151325.1.6122 WP_004151325.1.61416 WP_004151325.1.61556 WP_004151325.1.61572 WP_004151325.1.61640 WP_004151325.1.6180 WP_004151325.1.61812 WP_004151325.1.61994 WP_004151325.1.620 WP_004151325.1.62050 WP_004151325.1.62082 WP_004151325.1.62226 WP_004151325.1.62292 WP_004151325.1.62400 WP_004151325.1.62473 WP_004151325.1.62501 WP_004151325.1.62579 WP_004151325.1.62603 WP_004151325.1.6265 WP_004151325.1.62664 WP_004151325.1.62719 WP_004151325.1.62733 WP_004151325.1.62734 WP_004151325.1.62765 WP_004151325.1.63164 WP_004151325.1.63309 WP_004151325.1.63395 WP_004151325.1.6347 WP_004151325.1.63750 WP_004151325.1.6379 WP_004151325.1.63968 WP_004151325.1.63972 WP_004151325.1.64001 WP_004151325.1.6401 WP_004151325.1.64099 WP_004151325.1.64143 WP_004151325.1.64187 WP_004151325.1.64348 WP_004151325.1.64427 WP_004151325.1.64484 WP_004151325.1.64593 WP_004151325.1.64768 WP_004151325.1.64865 WP_004151325.1.65021 WP_004151325.1.65077 WP_004151325.1.65108 WP_004151325.1.65215 WP_004151325.1.65398 WP_004151325.1.65421 WP_004151325.1.65530 WP_004151325.1.65552 WP_004151325.1.65603 WP_004151325.1.65611 WP_004151325.1.65845 WP_004151325.1.66019 WP_004151325.1.66047 WP_004151325.1.6610 WP_004151325.1.66108 WP_004151325.1.66117 WP_004151325.1.66339 WP_004151325.1.66430 WP_004151325.1.66597 WP_004151325.1.66740 WP_004151325.1.6678 WP_004151325.1.66839 WP_004151325.1.66896 WP_004151325.1.66930 WP_004151325.1.66947 WP_004151325.1.6715 WP_004151325.1.67313 WP_004151325.1.6737 WP_004151325.1.67492 WP_004151325.1.67512 WP_004151325.1.6754 WP_004151325.1.67766 WP_004151325.1.6779 WP_004151325.1.67929 WP_004151325.1.67946 WP_004151325.1.68519 WP_004151325.1.68659 WP_004151325.1.68768 WP_004151325.1.68844 WP_004151325.1.68940 WP_004151325.1.68946 WP_004151325.1.69027 WP_004151325.1.69028 WP_004151325.1.6912 WP_004151325.1.69384 WP_004151325.1.69453 WP_004151325.1.69576 WP_004151325.1.69595 WP_004151325.1.69635 WP_004151325.1.69637 WP_004151325.1.69719 WP_004151325.1.69738 WP_004151325.1.69744 WP_004151325.1.69753 WP_004151325.1.69814 WP_004151325.1.69836 WP_004151325.1.69915 WP_004151325.1.70101 WP_004151325.1.70112 WP_004151325.1.702 WP_004151325.1.70718 WP_004151325.1.70847 WP_004151325.1.70859 WP_004151325.1.70870 WP_004151325.1.70873 WP_004151325.1.71212 WP_004151325.1.71286 WP_004151325.1.71291 WP_004151325.1.71296 WP_004151325.1.71393 WP_004151325.1.71838 WP_004151325.1.71913 WP_004151325.1.72139 WP_004151325.1.72201 WP_004151325.1.72274 WP_004151325.1.72609 WP_004151325.1.72632 WP_004151325.1.72673 WP_004151325.1.72735 WP_004151325.1.72746 WP_004151325.1.73038 WP_004151325.1.73208 WP_004151325.1.73301 WP_004151325.1.73316 WP_004151325.1.73472 WP_004151325.1.73589 WP_004151325.1.73732 WP_004151325.1.73742 WP_004151325.1.73904 WP_004151325.1.74001 WP_004151325.1.74048 WP_004151325.1.74176 WP_004151325.1.74256 WP_004151325.1.7455 WP_004151325.1.74692 WP_004151325.1.747 WP_004151325.1.74817 WP_004151325.1.74839 WP_004151325.1.74847 WP_004151325.1.74981 WP_004151325.1.75013 WP_004151325.1.75014 WP_004151325.1.75035 WP_004151325.1.75366 WP_004151325.1.75396 WP_004151325.1.75561 WP_004151325.1.75572 WP_004151325.1.75592 WP_004151325.1.75637 WP_004151325.1.7574 WP_004151325.1.7578 WP_004151325.1.75784 WP_004151325.1.75909 WP_004151325.1.75961 WP_004151325.1.76090 WP_004151325.1.7623 WP_004151325.1.76292 WP_004151325.1.76412 WP_004151325.1.76607 WP_004151325.1.76819 WP_004151325.1.76832 WP_004151325.1.76889 WP_004151325.1.77077 WP_004151325.1.77085 WP_004151325.1.77105 WP_004151325.1.77211 WP_004151325.1.77304 WP_004151325.1.7733 WP_004151325.1.77367 WP_004151325.1.77516 WP_004151325.1.77545 WP_004151325.1.77655 WP_004151325.1.7773 WP_004151325.1.77800 WP_004151325.1.77802 WP_004151325.1.77875 WP_004151325.1.78001 WP_004151325.1.7811 WP_004151325.1.78214 WP_004151325.1.78260 WP_004151325.1.78350 WP_004151325.1.78472 WP_004151325.1.78534 WP_004151325.1.7858 WP_004151325.1.78591 WP_004151325.1.78725 WP_004151325.1.78745 WP_004151325.1.78772 WP_004151325.1.78861 WP_004151325.1.78922 WP_004151325.1.78950 WP_004151325.1.78962 WP_004151325.1.78981 WP_004151325.1.79108 WP_004151325.1.79109 WP_004151325.1.79141 WP_004151325.1.79175 WP_004151325.1.79266 WP_004151325.1.7935 WP_004151325.1.79420 WP_004151325.1.79541 WP_004151325.1.79608 WP_004151325.1.79636 WP_004151325.1.79868 WP_004151325.1.8001 WP_004151325.1.80027 WP_004151325.1.80062 WP_004151325.1.80227 WP_004151325.1.80362 WP_004151325.1.8056 WP_004151325.1.807 WP_004151325.1.80771 WP_004151325.1.80772 WP_004151325.1.81144 WP_004151325.1.81191 WP_004151325.1.81212 WP_004151325.1.81282 WP_004151325.1.81449 WP_004151325.1.81452 WP_004151325.1.81659 WP_004151325.1.81683 WP_004151325.1.81759 WP_004151325.1.81835 WP_004151325.1.81841 WP_004151325.1.82003 WP_004151325.1.82022 WP_004151325.1.82034 WP_004151325.1.82299 WP_004151325.1.82367 WP_004151325.1.82446 WP_004151325.1.82641 WP_004151325.1.82795 WP_004151325.1.82939 WP_004151325.1.8296 WP_004151325.1.82963 WP_004151325.1.83014 WP_004151325.1.83022 WP_004151325.1.83076 WP_004151325.1.83117 WP_004151325.1.8320 WP_004151325.1.83263 WP_004151325.1.83285 WP_004151325.1.83387 WP_004151325.1.83556 WP_004151325.1.83746 WP_004151325.1.84066 WP_004151325.1.84309 WP_004151325.1.84315 WP_004151325.1.8448 WP_004151325.1.84502 WP_004151325.1.84549 WP_004151325.1.84560 WP_004151325.1.84681 WP_004151325.1.84787 WP_004151325.1.84900 WP_004151325.1.85005 WP_004151325.1.85010 WP_004151325.1.85063 WP_004151325.1.85102 WP_004151325.1.85191 WP_004151325.1.85193 WP_004151325.1.85366 WP_004151325.1.85423 WP_004151325.1.85564 WP_004151325.1.85680 WP_004151325.1.85761 WP_004151325.1.85783 WP_004151325.1.85785 WP_004151325.1.85805 WP_004151325.1.85954 WP_004151325.1.85985 WP_004151325.1.86074 WP_004151325.1.86169 WP_004151325.1.86528 WP_004151325.1.86556 WP_004151325.1.86668 WP_004151325.1.86778 WP_004151325.1.86835 WP_004151325.1.86946 WP_004151325.1.87113 WP_004151325.1.87130 WP_004151325.1.87132 WP_004151325.1.87140 WP_004151325.1.87202 WP_004151325.1.87212 WP_004151325.1.87214 WP_004151325.1.87392 WP_004151325.1.87437 WP_004151325.1.87441 WP_004151325.1.8763 WP_004151325.1.87645 WP_004151325.1.87793 WP_004151325.1.87907 WP_004151325.1.87962 WP_004151325.1.88186 WP_004151325.1.88298 WP_004151325.1.8851 WP_004151325.1.88551 WP_004151325.1.88568 WP_004151325.1.88645 WP_004151325.1.88655 WP_004151325.1.88702 WP_004151325.1.88823 WP_004151325.1.88870 WP_004151325.1.88875 WP_004151325.1.88885 WP_004151325.1.8905 WP_004151325.1.892 WP_004151325.1.89259 WP_004151325.1.89318 WP_004151325.1.89326 WP_004151325.1.89340 WP_004151325.1.89467 WP_004151325.1.89692 WP_004151325.1.89722 WP_004151325.1.8983 WP_004151325.1.89958 WP_004151325.1.90020 WP_004151325.1.90051 WP_004151325.1.901 WP_004151325.1.9025 WP_004151325.1.90297 WP_004151325.1.90355 WP_004151325.1.90374 WP_004151325.1.90383 WP_004151325.1.90469 WP_004151325.1.90515 WP_004151325.1.90662 WP_004151325.1.90699 WP_004151325.1.90802 WP_004151325.1.90870 WP_004151325.1.90877 WP_004151325.1.90904 WP_004151325.1.9092 WP_004151325.1.90947 WP_004151325.1.90993 WP_004151325.1.91033 WP_004151325.1.91134 WP_004151325.1.91187 WP_004151325.1.91319 WP_004151325.1.91402 WP_004151325.1.91435 WP_004151325.1.91461 WP_004151325.1.91550 WP_004151325.1.9170 WP_004151325.1.91725 WP_004151325.1.91741 WP_004151325.1.918 WP_004151325.1.91842 WP_004151325.1.91847 WP_004151325.1.91900 WP_004151325.1.91981 WP_004151325.1.92020 WP_004151325.1.92035 WP_004151325.1.92066 WP_004151325.1.92117 WP_004151325.1.92189 WP_004151325.1.92209 WP_004151325.1.92246 WP_004151325.1.92569 WP_004151325.1.9258 WP_004151325.1.9259 WP_004151325.1.92601 WP_004151325.1.92608 WP_004151325.1.92771 WP_004151325.1.92782 WP_004151325.1.9300 WP_004151325.1.93004 WP_004151325.1.93070 WP_004151325.1.93081 WP_004151325.1.93132 WP_004151325.1.93246 WP_004151325.1.93256 WP_004151325.1.93278 WP_004151325.1.93445 WP_004151325.1.9383 WP_004151325.1.94021 WP_004151325.1.94163 WP_004151325.1.94200 WP_004151325.1.94290 WP_004151325.1.94599 WP_004151325.1.94605 WP_004151325.1.94642 WP_004151325.1.94777 WP_004151325.1.94894 WP_004151325.1.95021 WP_004151325.1.95030 WP_004151325.1.95122 WP_004151325.1.95429 WP_004151325.1.95486 WP_004151325.1.95524 WP_004151325.1.95527 WP_004151325.1.95593 WP_004151325.1.95723 WP_004151325.1.95843 WP_004151325.1.95889 WP_004151325.1.96202 WP_004151325.1.9626 WP_004151325.1.96375 WP_004151325.1.96383 WP_004151325.1.96405 WP_004151325.1.9651 WP_004151325.1.96653 WP_004151325.1.96684 WP_004151325.1.96793 WP_004151325.1.96802 WP_004151325.1.96842 WP_004151325.1.96915 WP_004151325.1.96979 WP_004151325.1.97037 WP_004151325.1.97114 WP_004151325.1.97197 WP_004151325.1.97236 WP_004151325.1.97263 WP_004151325.1.97294 WP_004151325.1.97333 WP_004151325.1.97416 WP_004151325.1.97419 WP_004151325.1.97475 WP_004151325.1.97680 WP_004151325.1.97734 WP_004151325.1.97759 WP_004151325.1.97794 WP_004151325.1.97833 WP_004151325.1.98278 WP_004151325.1.98320 WP_004151325.1.98336 WP_004151325.1.98408 WP_004151325.1.98450 WP_004151325.1.98553 WP_004151325.1.98728 WP_004151325.1.9875 WP_004151325.1.98774 WP_004151325.1.98932 WP_004151325.1.98973 WP_004151325.1.99166 WP_004151325.1.99248 WP_004151325.1.99279 WP_004151325.1.99305 WP_004151325.1.99691 WP_004151325.1.99706 WP_004151325.1.99778 WP_004151325.1.99885 YP_005225514.1.24690 gi|152969038|ref|YP_001334147.1| 272620.KPN_00466 gi|530631581|ref|YP_008426849.1| gi|378977373|ref|YP_005225514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]