SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_03601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_03601
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_03601
Sequence length 96
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MSGQLSWTREGETLALHGELDQDLLVPLWEARAQATAGTAIIDLSQTTRVDTAGLALLVH
FMALIRRQGREAQLVGKSENLQTLIGLYNLPADLIS
Download sequence
Identical sequences A0A2D2J5B7 A6TEL0 C8T5N0 R4YFJ4
272620.KPN_03601 WP_004144912.1.100698 WP_004144912.1.100964 WP_004144912.1.101749 WP_004144912.1.10213 WP_004144912.1.10241 WP_004144912.1.12564 WP_004144912.1.12900 WP_004144912.1.13149 WP_004144912.1.13660 WP_004144912.1.14830 WP_004144912.1.16314 WP_004144912.1.16877 WP_004144912.1.17326 WP_004144912.1.17661 WP_004144912.1.18736 WP_004144912.1.20019 WP_004144912.1.20205 WP_004144912.1.21799 WP_004144912.1.22471 WP_004144912.1.2265 WP_004144912.1.23877 WP_004144912.1.24095 WP_004144912.1.24209 WP_004144912.1.25306 WP_004144912.1.25379 WP_004144912.1.25407 WP_004144912.1.25933 WP_004144912.1.26336 WP_004144912.1.2683 WP_004144912.1.27264 WP_004144912.1.27722 WP_004144912.1.27809 WP_004144912.1.28857 WP_004144912.1.28972 WP_004144912.1.29583 WP_004144912.1.29858 WP_004144912.1.30072 WP_004144912.1.31257 WP_004144912.1.33406 WP_004144912.1.33414 WP_004144912.1.33838 WP_004144912.1.34200 WP_004144912.1.34281 WP_004144912.1.34748 WP_004144912.1.3525 WP_004144912.1.35824 WP_004144912.1.36084 WP_004144912.1.36204 WP_004144912.1.38094 WP_004144912.1.38096 WP_004144912.1.38448 WP_004144912.1.38593 WP_004144912.1.38684 WP_004144912.1.39391 WP_004144912.1.39705 WP_004144912.1.4131 WP_004144912.1.41352 WP_004144912.1.41405 WP_004144912.1.43146 WP_004144912.1.43228 WP_004144912.1.43445 WP_004144912.1.43836 WP_004144912.1.43867 WP_004144912.1.44235 WP_004144912.1.45607 WP_004144912.1.45911 WP_004144912.1.46221 WP_004144912.1.4697 WP_004144912.1.47379 WP_004144912.1.48606 WP_004144912.1.49133 WP_004144912.1.49307 WP_004144912.1.49877 WP_004144912.1.50429 WP_004144912.1.50730 WP_004144912.1.50927 WP_004144912.1.51176 WP_004144912.1.517 WP_004144912.1.51922 WP_004144912.1.522 WP_004144912.1.52287 WP_004144912.1.52425 WP_004144912.1.52775 WP_004144912.1.53472 WP_004144912.1.54676 WP_004144912.1.55048 WP_004144912.1.55577 WP_004144912.1.55658 WP_004144912.1.55741 WP_004144912.1.5576 WP_004144912.1.57624 WP_004144912.1.57886 WP_004144912.1.60483 WP_004144912.1.60774 WP_004144912.1.62719 WP_004144912.1.63098 WP_004144912.1.63294 WP_004144912.1.63802 WP_004144912.1.63956 WP_004144912.1.64191 WP_004144912.1.66070 WP_004144912.1.6644 WP_004144912.1.66613 WP_004144912.1.66709 WP_004144912.1.66714 WP_004144912.1.68189 WP_004144912.1.70543 WP_004144912.1.7087 WP_004144912.1.71611 WP_004144912.1.7273 WP_004144912.1.73236 WP_004144912.1.7390 WP_004144912.1.74759 WP_004144912.1.75283 WP_004144912.1.75457 WP_004144912.1.76912 WP_004144912.1.77831 WP_004144912.1.78103 WP_004144912.1.7974 WP_004144912.1.80350 WP_004144912.1.80412 WP_004144912.1.80554 WP_004144912.1.80692 WP_004144912.1.80816 WP_004144912.1.81675 WP_004144912.1.83691 WP_004144912.1.8464 WP_004144912.1.85115 WP_004144912.1.85263 WP_004144912.1.858 WP_004144912.1.85877 WP_004144912.1.85957 WP_004144912.1.8667 WP_004144912.1.86778 WP_004144912.1.87235 WP_004144912.1.87313 WP_004144912.1.8853 WP_004144912.1.8896 WP_004144912.1.89430 WP_004144912.1.90446 WP_004144912.1.90516 WP_004144912.1.90879 WP_004144912.1.91534 WP_004144912.1.925 WP_004144912.1.93226 WP_004144912.1.93342 WP_004144912.1.94871 WP_004144912.1.9521 WP_004144912.1.95349 WP_004144912.1.95927 WP_004144912.1.96374 WP_004144912.1.96842 WP_004144912.1.98450 WP_004144912.1.99705 WP_004144912.1.9996 gi|152972115|ref|YP_001337261.1| gi|529990381|ref|YP_007993767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]