SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_pKPN5p08247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_pKPN5p08247
Domain Number 1 Region: 388-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000153
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_pKPN5p08247
Sequence length 492
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MLLSSTRKDWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPQVGLYSAFCIPLVMAFL
GGRPAMISSATGAMALLLITLVKDHGLQYLLAASALTGVLQLAAGYLKLGSLMRYVSRSV
VTGFVNALAILIFMAQLPELTNVTWHVYALTAAGLGIIYLFPYLNKTIPSPLVCIIVLTA
ISMWLHLDVRTVGDMGKLPDSLPVFLIPDIPLNLDTLMIILPYSAGLAVVGLLESMMTAT
IVDDMTDTPSDKNRECKAQGVANICTSFIGGMAGCAMIGQSVINVKSGGRGRLSTLTAGV
VLLLMVVFLRDWVSRIPMAALVAVMIMVSIGTFSWRSISNLRSHPLSTSVVMLATVVVVV
ATDNLAFGVLTGVLIASLNFATKVARFMAVSSELKDDTRTYTVAGQVFFASSDRFMSHFD
FREAVERVVIDVTHAHFWDITSVSALDRVVIKFRREGTEVEIKGMNDATRTLVDRFGVHD
KPEEVEKLMGGH
Download sequence
Identical sequences A0A060VBC7 A0A097R2A7 A0A0B7GEV2 A0A0T5XIC3 A0A0X6ZFP1 A0A142I4W5 A0A1C1EFA8 A0A1P7U062 A0A1W1KQV2 A0A223UJG6 A0A256DLG0 A0A285AUV3 A0A2G5A510 A0A2G8N7I9 A0A2H4UE51 A0A2J9LQ85 A6TJ54 W8CTY9
gi|152973818|ref|YP_001338857.1|NC_009651 gi|397660812|ref|YP_006501513.1|NC_018107 gi|608787017|ref|YP_009023399.1|NC_023911 272620.KPN_pKPN5p08247 gi|152973818|ref|YP_001338857.1| WP_001549885.1.100385 WP_001549885.1.100698 WP_001549885.1.100746 WP_001549885.1.101034 WP_001549885.1.101766 WP_001549885.1.10264 WP_001549885.1.10333 WP_001549885.1.10864 WP_001549885.1.11122 WP_001549885.1.11267 WP_001549885.1.11478 WP_001549885.1.11891 WP_001549885.1.12747 WP_001549885.1.13174 WP_001549885.1.1359 WP_001549885.1.14248 WP_001549885.1.14407 WP_001549885.1.14580 WP_001549885.1.14585 WP_001549885.1.1464 WP_001549885.1.14677 WP_001549885.1.14692 WP_001549885.1.15207 WP_001549885.1.15212 WP_001549885.1.1531 WP_001549885.1.15360 WP_001549885.1.15725 WP_001549885.1.16314 WP_001549885.1.1728 WP_001549885.1.18200 WP_001549885.1.18305 WP_001549885.1.18353 WP_001549885.1.196 WP_001549885.1.19989 WP_001549885.1.20193 WP_001549885.1.20269 WP_001549885.1.2031 WP_001549885.1.20528 WP_001549885.1.21019 WP_001549885.1.21483 WP_001549885.1.21905 WP_001549885.1.21968 WP_001549885.1.22929 WP_001549885.1.23372 WP_001549885.1.23437 WP_001549885.1.24126 WP_001549885.1.24211 WP_001549885.1.24353 WP_001549885.1.25620 WP_001549885.1.2571 WP_001549885.1.26557 WP_001549885.1.2675 WP_001549885.1.27089 WP_001549885.1.27144 WP_001549885.1.27477 WP_001549885.1.27543 WP_001549885.1.27959 WP_001549885.1.28368 WP_001549885.1.2990 WP_001549885.1.30303 WP_001549885.1.30339 WP_001549885.1.30551 WP_001549885.1.30644 WP_001549885.1.30857 WP_001549885.1.31400 WP_001549885.1.31459 WP_001549885.1.31671 WP_001549885.1.3195 WP_001549885.1.32013 WP_001549885.1.3218 WP_001549885.1.32256 WP_001549885.1.32979 WP_001549885.1.33399 WP_001549885.1.33497 WP_001549885.1.33797 WP_001549885.1.3397 WP_001549885.1.34011 WP_001549885.1.34213 WP_001549885.1.34386 WP_001549885.1.3450 WP_001549885.1.34757 WP_001549885.1.34882 WP_001549885.1.35109 WP_001549885.1.35284 WP_001549885.1.35417 WP_001549885.1.35585 WP_001549885.1.35824 WP_001549885.1.35951 WP_001549885.1.35959 WP_001549885.1.36339 WP_001549885.1.36388 WP_001549885.1.36477 WP_001549885.1.36676 WP_001549885.1.37462 WP_001549885.1.37697 WP_001549885.1.37860 WP_001549885.1.39250 WP_001549885.1.39370 WP_001549885.1.40069 WP_001549885.1.40108 WP_001549885.1.40344 WP_001549885.1.40432 WP_001549885.1.40967 WP_001549885.1.40980 WP_001549885.1.41405 WP_001549885.1.41794 WP_001549885.1.4181 WP_001549885.1.41890 WP_001549885.1.41992 WP_001549885.1.42163 WP_001549885.1.42395 WP_001549885.1.4251 WP_001549885.1.42742 WP_001549885.1.42755 WP_001549885.1.42939 WP_001549885.1.42953 WP_001549885.1.43497 WP_001549885.1.44028 WP_001549885.1.44085 WP_001549885.1.44707 WP_001549885.1.45106 WP_001549885.1.45250 WP_001549885.1.45338 WP_001549885.1.45594 WP_001549885.1.46179 WP_001549885.1.46254 WP_001549885.1.46458 WP_001549885.1.46462 WP_001549885.1.46717 WP_001549885.1.46968 WP_001549885.1.46985 WP_001549885.1.47885 WP_001549885.1.48303 WP_001549885.1.48521 WP_001549885.1.48609 WP_001549885.1.48950 WP_001549885.1.49014 WP_001549885.1.49209 WP_001549885.1.49267 WP_001549885.1.49817 WP_001549885.1.49890 WP_001549885.1.50370 WP_001549885.1.50650 WP_001549885.1.50848 WP_001549885.1.51563 WP_001549885.1.51853 WP_001549885.1.51918 WP_001549885.1.51931 WP_001549885.1.52021 WP_001549885.1.52483 WP_001549885.1.52764 WP_001549885.1.53269 WP_001549885.1.5341 WP_001549885.1.53623 WP_001549885.1.5449 WP_001549885.1.54739 WP_001549885.1.55515 WP_001549885.1.55794 WP_001549885.1.5659 WP_001549885.1.56599 WP_001549885.1.56728 WP_001549885.1.57139 WP_001549885.1.57436 WP_001549885.1.57630 WP_001549885.1.57747 WP_001549885.1.57779 WP_001549885.1.57871 WP_001549885.1.5820 WP_001549885.1.58262 WP_001549885.1.58380 WP_001549885.1.58426 WP_001549885.1.58439 WP_001549885.1.59172 WP_001549885.1.59559 WP_001549885.1.59936 WP_001549885.1.60287 WP_001549885.1.60922 WP_001549885.1.60984 WP_001549885.1.61618 WP_001549885.1.6191 WP_001549885.1.61973 WP_001549885.1.62117 WP_001549885.1.62234 WP_001549885.1.62306 WP_001549885.1.62958 WP_001549885.1.63404 WP_001549885.1.64202 WP_001549885.1.64612 WP_001549885.1.65411 WP_001549885.1.65602 WP_001549885.1.66152 WP_001549885.1.66271 WP_001549885.1.66936 WP_001549885.1.67088 WP_001549885.1.67765 WP_001549885.1.67858 WP_001549885.1.6818 WP_001549885.1.68510 WP_001549885.1.68620 WP_001549885.1.68691 WP_001549885.1.69565 WP_001549885.1.69613 WP_001549885.1.69691 WP_001549885.1.70009 WP_001549885.1.70243 WP_001549885.1.70647 WP_001549885.1.71364 WP_001549885.1.71943 WP_001549885.1.7223 WP_001549885.1.72341 WP_001549885.1.72406 WP_001549885.1.72757 WP_001549885.1.73371 WP_001549885.1.73558 WP_001549885.1.73597 WP_001549885.1.74068 WP_001549885.1.74514 WP_001549885.1.74732 WP_001549885.1.7483 WP_001549885.1.75418 WP_001549885.1.75608 WP_001549885.1.76266 WP_001549885.1.76286 WP_001549885.1.76849 WP_001549885.1.76941 WP_001549885.1.77381 WP_001549885.1.77467 WP_001549885.1.77655 WP_001549885.1.7769 WP_001549885.1.77910 WP_001549885.1.78358 WP_001549885.1.78555 WP_001549885.1.78730 WP_001549885.1.78829 WP_001549885.1.78853 WP_001549885.1.79019 WP_001549885.1.79148 WP_001549885.1.7974 WP_001549885.1.79756 WP_001549885.1.80172 WP_001549885.1.80337 WP_001549885.1.8078 WP_001549885.1.80869 WP_001549885.1.81147 WP_001549885.1.8153 WP_001549885.1.82874 WP_001549885.1.82926 WP_001549885.1.83138 WP_001549885.1.83202 WP_001549885.1.83675 WP_001549885.1.84650 WP_001549885.1.84801 WP_001549885.1.85482 WP_001549885.1.85516 WP_001549885.1.85983 WP_001549885.1.86031 WP_001549885.1.87146 WP_001549885.1.87256 WP_001549885.1.8730 WP_001549885.1.87313 WP_001549885.1.87337 WP_001549885.1.87359 WP_001549885.1.88451 WP_001549885.1.88822 WP_001549885.1.89074 WP_001549885.1.89142 WP_001549885.1.8952 WP_001549885.1.89524 WP_001549885.1.89602 WP_001549885.1.89623 WP_001549885.1.90344 WP_001549885.1.9052 WP_001549885.1.90685 WP_001549885.1.90789 WP_001549885.1.91301 WP_001549885.1.91682 WP_001549885.1.91799 WP_001549885.1.91921 WP_001549885.1.92287 WP_001549885.1.92799 WP_001549885.1.9289 WP_001549885.1.93757 WP_001549885.1.94860 WP_001549885.1.94918 WP_001549885.1.95742 WP_001549885.1.96225 WP_001549885.1.96802 WP_001549885.1.96842 WP_001549885.1.97684 WP_001549885.1.9777 WP_001549885.1.97933 WP_001549885.1.98127 WP_001549885.1.98371 WP_001549885.1.98530 WP_001549885.1.98937 WP_001549885.1.992 WP_001549885.1.99264 WP_001549885.1.99344 gi|397660812|ref|YP_006501513.1| APC63117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]