SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272624.lpg2958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272624.lpg2958
Domain Number 1 Region: 72-260
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.49e-28
Family Clp protease, ClpP subunit 0.018
Further Details:      
 
Domain Number 2 Region: 432-495
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000654
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272624.lpg2958
Sequence length 501
Comment (Legionella pneumophila Philadelphia 1)
Sequence
MHRDCVRQEGLHKLNNFFCKLAVVKRILQGMIFKRRLSDSVHEDSDSVATKQSPASVTCE
KGLSKLMQTSCIFIFLTLFLLIGLQTSFAAKIVELNIKGPIGPATVDYMERGIKSAQDAD
LIVILIDTPGGLYDSTRNIIQLFLLSDVPIVTYVSPTGARAASAGTYLMYASTIAAMAPG
TQMGAASPVSLGTGFSEGEKDEKKKSTMENKVTHDAVATIRSLAQLRGRDPDFAEKAVTE
GKSITANEALSKGVVNYIAKNRDDLLSQIHGIKVSQNNKTITINTESPDIQVINPDWRTR
FLSVITNPTVAYLLLLLGIYGIFFELVNPGYVLPGVVGAVSMLFALYALQLLPINYAGLG
LIILGILFVIAEAFTPSFGALGVGGTVSFILGSIMLMNTEHLAFQIAWSAIWAMAVLNIL
IFVLVLGMLIKSRNQKIRHGLETLVGAKGRALGDINLEGQAVIKGEIWNVHSSSPIAANK
SVKVTRASGLLLEVEEDQSVY
Download sequence
Identical sequences A0A2J9NF44 G8UVZ0 Q5ZRC4
gi|509152305|ref|YP_008064679.1| gi|378778841|ref|YP_005187283.1| gi|470180715|ref|YP_007566590.1| WP_010948643.1.100881 WP_010948643.1.101385 WP_010948643.1.10160 WP_010948643.1.11666 WP_010948643.1.1188 WP_010948643.1.12035 WP_010948643.1.12661 WP_010948643.1.14235 WP_010948643.1.15016 WP_010948643.1.16078 WP_010948643.1.16593 WP_010948643.1.16748 WP_010948643.1.16962 WP_010948643.1.17857 WP_010948643.1.19321 WP_010948643.1.19554 WP_010948643.1.20369 WP_010948643.1.2062 WP_010948643.1.2085 WP_010948643.1.21466 WP_010948643.1.21493 WP_010948643.1.21924 WP_010948643.1.22734 WP_010948643.1.22766 WP_010948643.1.2333 WP_010948643.1.23459 WP_010948643.1.24053 WP_010948643.1.24333 WP_010948643.1.2441 WP_010948643.1.24636 WP_010948643.1.26718 WP_010948643.1.27038 WP_010948643.1.27501 WP_010948643.1.27674 WP_010948643.1.28814 WP_010948643.1.29318 WP_010948643.1.29802 WP_010948643.1.30583 WP_010948643.1.30653 WP_010948643.1.30822 WP_010948643.1.31291 WP_010948643.1.32608 WP_010948643.1.32615 WP_010948643.1.32659 WP_010948643.1.33479 WP_010948643.1.33708 WP_010948643.1.35118 WP_010948643.1.35787 WP_010948643.1.36420 WP_010948643.1.37108 WP_010948643.1.37274 WP_010948643.1.37932 WP_010948643.1.3819 WP_010948643.1.38679 WP_010948643.1.40870 WP_010948643.1.41185 WP_010948643.1.41378 WP_010948643.1.41486 WP_010948643.1.44619 WP_010948643.1.44866 WP_010948643.1.45024 WP_010948643.1.46042 WP_010948643.1.46096 WP_010948643.1.47823 WP_010948643.1.47956 WP_010948643.1.48346 WP_010948643.1.51153 WP_010948643.1.51428 WP_010948643.1.51956 WP_010948643.1.52283 WP_010948643.1.52706 WP_010948643.1.52905 WP_010948643.1.53250 WP_010948643.1.53669 WP_010948643.1.53795 WP_010948643.1.53844 WP_010948643.1.54355 WP_010948643.1.57055 WP_010948643.1.57468 WP_010948643.1.58606 WP_010948643.1.58931 WP_010948643.1.59227 WP_010948643.1.59576 WP_010948643.1.60239 WP_010948643.1.60770 WP_010948643.1.61895 WP_010948643.1.62077 WP_010948643.1.63282 WP_010948643.1.64335 WP_010948643.1.64388 WP_010948643.1.64512 WP_010948643.1.64856 WP_010948643.1.66209 WP_010948643.1.66299 WP_010948643.1.68412 WP_010948643.1.68702 WP_010948643.1.69197 WP_010948643.1.70346 WP_010948643.1.70691 WP_010948643.1.7124 WP_010948643.1.71556 WP_010948643.1.73029 WP_010948643.1.73915 WP_010948643.1.74438 WP_010948643.1.75353 WP_010948643.1.75911 WP_010948643.1.76298 WP_010948643.1.76893 WP_010948643.1.77472 WP_010948643.1.77852 WP_010948643.1.77866 WP_010948643.1.79027 WP_010948643.1.79030 WP_010948643.1.80678 WP_010948643.1.80733 WP_010948643.1.80817 WP_010948643.1.81970 WP_010948643.1.82765 WP_010948643.1.83499 WP_010948643.1.8363 WP_010948643.1.84081 WP_010948643.1.85699 WP_010948643.1.86349 WP_010948643.1.86607 WP_010948643.1.87629 WP_010948643.1.87656 WP_010948643.1.88081 WP_010948643.1.89135 WP_010948643.1.89155 WP_010948643.1.89171 WP_010948643.1.90392 WP_010948643.1.90650 WP_010948643.1.91256 WP_010948643.1.91480 WP_010948643.1.93200 WP_010948643.1.94508 WP_010948643.1.9567 WP_010948643.1.96018 WP_010948643.1.96198 WP_010948643.1.97528 WP_010948643.1.97598 WP_010948643.1.97635 WP_010948643.1.98470 WP_010948643.1.98928 WP_010948643.1.9970 YP_096951.1.86292 gi|52843152|ref|YP_096951.1| 272624.lpg2958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]