SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272626.lin0409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin0409
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000017
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin0409
Sequence length 99
Comment (Listeria innocua)
Sequence
MKHNFTEDDFVYGESWGLVHRGVLEDKEIERMKALRDKVVGKKGVAQTTLKPIGSVRIDG
EVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK
Download sequence
Identical sequences A0A0E0UTI3 A0A1E8E931 A0A2G8Q9Q2 Q92EP9
gi|284993864|ref|YP_003415632.1| gi|386025705|ref|YP_005946481.1| 272626.lin0409 552536.LMHCC_2245 gi|386007117|ref|YP_005925395.1| gi|404406860|ref|YP_006689575.1| WP_003738085.1.100060 WP_003738085.1.100651 WP_003738085.1.100835 WP_003738085.1.101354 WP_003738085.1.10198 WP_003738085.1.10484 WP_003738085.1.1123 WP_003738085.1.11633 WP_003738085.1.12634 WP_003738085.1.13052 WP_003738085.1.13234 WP_003738085.1.1556 WP_003738085.1.17352 WP_003738085.1.1764 WP_003738085.1.1794 WP_003738085.1.19189 WP_003738085.1.19626 WP_003738085.1.22202 WP_003738085.1.22383 WP_003738085.1.22962 WP_003738085.1.23419 WP_003738085.1.24546 WP_003738085.1.25788 WP_003738085.1.26060 WP_003738085.1.26138 WP_003738085.1.26146 WP_003738085.1.26166 WP_003738085.1.26523 WP_003738085.1.2662 WP_003738085.1.27839 WP_003738085.1.28076 WP_003738085.1.28123 WP_003738085.1.2832 WP_003738085.1.28325 WP_003738085.1.29723 WP_003738085.1.30706 WP_003738085.1.30827 WP_003738085.1.30882 WP_003738085.1.30902 WP_003738085.1.32209 WP_003738085.1.33039 WP_003738085.1.33240 WP_003738085.1.337 WP_003738085.1.3389 WP_003738085.1.34326 WP_003738085.1.36582 WP_003738085.1.37882 WP_003738085.1.38150 WP_003738085.1.38281 WP_003738085.1.38792 WP_003738085.1.38800 WP_003738085.1.39220 WP_003738085.1.39262 WP_003738085.1.39351 WP_003738085.1.39552 WP_003738085.1.40263 WP_003738085.1.40504 WP_003738085.1.40976 WP_003738085.1.41348 WP_003738085.1.41603 WP_003738085.1.42616 WP_003738085.1.43327 WP_003738085.1.44147 WP_003738085.1.44897 WP_003738085.1.4510 WP_003738085.1.45295 WP_003738085.1.4557 WP_003738085.1.45759 WP_003738085.1.45803 WP_003738085.1.45877 WP_003738085.1.46045 WP_003738085.1.46064 WP_003738085.1.46314 WP_003738085.1.46653 WP_003738085.1.46883 WP_003738085.1.47203 WP_003738085.1.47738 WP_003738085.1.48624 WP_003738085.1.50971 WP_003738085.1.5099 WP_003738085.1.51435 WP_003738085.1.51650 WP_003738085.1.53566 WP_003738085.1.53807 WP_003738085.1.54046 WP_003738085.1.54181 WP_003738085.1.5472 WP_003738085.1.55231 WP_003738085.1.5631 WP_003738085.1.56923 WP_003738085.1.59571 WP_003738085.1.60258 WP_003738085.1.60297 WP_003738085.1.60956 WP_003738085.1.62629 WP_003738085.1.62852 WP_003738085.1.64531 WP_003738085.1.65913 WP_003738085.1.66296 WP_003738085.1.67429 WP_003738085.1.67610 WP_003738085.1.67795 WP_003738085.1.67884 WP_003738085.1.69587 WP_003738085.1.70104 WP_003738085.1.70309 WP_003738085.1.7031 WP_003738085.1.71585 WP_003738085.1.71921 WP_003738085.1.72057 WP_003738085.1.72558 WP_003738085.1.73222 WP_003738085.1.73458 WP_003738085.1.74290 WP_003738085.1.74303 WP_003738085.1.74351 WP_003738085.1.74837 WP_003738085.1.75019 WP_003738085.1.75069 WP_003738085.1.75604 WP_003738085.1.76120 WP_003738085.1.76124 WP_003738085.1.76769 WP_003738085.1.77116 WP_003738085.1.77149 WP_003738085.1.77246 WP_003738085.1.7736 WP_003738085.1.78121 WP_003738085.1.78203 WP_003738085.1.78525 WP_003738085.1.79295 WP_003738085.1.79803 WP_003738085.1.79962 WP_003738085.1.80790 WP_003738085.1.80896 WP_003738085.1.81503 WP_003738085.1.81693 WP_003738085.1.81725 WP_003738085.1.81833 WP_003738085.1.82616 WP_003738085.1.82719 WP_003738085.1.83236 WP_003738085.1.83323 WP_003738085.1.83607 WP_003738085.1.84586 WP_003738085.1.87085 WP_003738085.1.87108 WP_003738085.1.87154 WP_003738085.1.88015 WP_003738085.1.88128 WP_003738085.1.88584 WP_003738085.1.89085 WP_003738085.1.89127 WP_003738085.1.89160 WP_003738085.1.8932 WP_003738085.1.89450 WP_003738085.1.90135 WP_003738085.1.9019 WP_003738085.1.90645 WP_003738085.1.9109 WP_003738085.1.91212 WP_003738085.1.92274 WP_003738085.1.93777 WP_003738085.1.93859 WP_003738085.1.93895 WP_003738085.1.95186 WP_003738085.1.95256 WP_003738085.1.96586 WP_003738085.1.9672 WP_003738085.1.97165 WP_003738085.1.97257 WP_003738085.1.97315 WP_003738085.1.98038 WP_003738085.1.98375 WP_003738085.1.9840 WP_003738085.1.99125 WP_003738085.1.99521 WP_003738085.1.99921 gi|284800678|ref|YP_003412543.1| gi|217965519|ref|YP_002351197.1| gi|16799486|ref|NP_469754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]