SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272626.lin0824 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin0824
Domain Number 1 Region: 788-1182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.72e-126
Family PFOR PP module 0.00000000434
Further Details:      
 
Domain Number 2 Region: 415-663
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000175
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.3e-73
Family PFOR Pyr module 0.0000000448
Further Details:      
 
Domain Number 4 Region: 259-406
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.28e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000332
Further Details:      
 
Domain Number 5 Region: 668-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.1e-20
Family Ferredoxin domains from multidomain proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272626.lin0824
Sequence length 1216
Comment (Listeria innocua)
Sequence
MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWSSKNKKNLFNEPVKVVEM
QSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELLPTVFHVSARTISAASL
NIFGDHSDVMAARQTGFAMLAEGSVQEVMDLSAVAHLASLKGSLPFLNFFDGFRTSHELQ
KVEVLEYDELENLLDKEALQQFRNRAMTPNNPKTLGSNQNPDIFFQQRETVNRYYEEIPS
IVQNYMQEINQLRGTDYDLVNYYGAEDATDVIVAMGSVTPVIEQVIDYLTTQGKKVGLLN
IRLYRPFPAETFLAKLPKTVERVAVLDRTKEPGSGGEPLLLDVQSVLYDSETRPLVIGGR
YGLGSKDVTPDQILGVYSHLTTEKPKPRFTIGITDDITNLSIENTGPSDLTSAKTFQCKF
WGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKSGGLTVSHLRFGENRIRSAYLIQ
QADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGEQLERHLPAAMREYIAKNNIQFYT
LNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKASAIATYGKKDMAVAEKNI
LAMDQTVANLHKVEVPESWANPVLTAEASTATEKPAYVKNILEPVNRLEGDNLTVGDLIS
NGMVSGAYPPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRPILTNEEEMESA
PEGFMTREMRGKDGLRYRIQVSPMDCTGCNLCAETCPAKDKALVMKPFEEVAAKENPNWS
FAINVKPKKNPGKKNTVPGSQFEQPLLEFSGACAGCGETPYVKLLTQMFGDRMMIANATG
CSSIWGASAPATPYTVNDQGHGPAWGNSLLEDNAEYGYGMYLANQTMRKALNNKVTKALA
NETISEGLREALSDWQNQMDVSEDTRDRAEALQLALLNEMKGNALLESIYRDRELFIKRS
QWMIGGDGWAYDIGFGGIDHVLASGEDVNIFVMDNEVYSNTGGQSSKATPTAAIAKFASG
GKSVGKKDLGIMAMSYGNIYVAQIAMGASKRQTLKAIEEAEAYPGPSLIIAYTPCINHGI
SSGMKTMLSETQKAVECGYWSLYRYNPLLEEKGKNPMVMDYKKVDFDQFEDFLKRETRYS
ALYKANPEVAAKLSEKTRLDAEKRFKRYATMAGLDLEKILKKKEVSEEATKKPVDDDRAA
RKAAREARRLAREQEK
Download sequence
Identical sequences Q92DI9
WP_010990629.1.46653 gi|16799898|ref|NP_470166.1| 272626.lin0824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]