SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272626.lin1683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin1683
Domain Number 1 Region: 156-265
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin1683
Sequence length 267
Comment (Listeria innocua)
Sequence
MQIKEFLISRRSEVVNNFYDNYYTQTDEYKLRLSAGEDEQSIRSLSTASCGMIIDVITGV
KERDFENIGKRRFNDKTDIRKIHQHMSEIDKFIINSLLKWKETEDVFYTDADIIQFMLEI
KDTLASIQQQLLEGFMQENRNQVMAQRKEIIQLSTRIIPITDSIGVLPIVGSLDDDRGYF
MKEKAIESADKLNLDFIVIDFSSAVLKDDFATKHMEDMIQSFKLIGLIPILSGMQPSFAQ
RTIQVGSNISKLQSFGSLEQALTNLGL
Download sequence
Identical sequences Q92B67
WP_003762527.1.41348 WP_003762527.1.46653 WP_003762527.1.51650 WP_003762527.1.70104 WP_003762527.1.83607 WP_003762527.1.99521 WP_003762527.1.99921 369009 gi|16800751|ref|NP_471019.1| 272626.lin1683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]