SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272626.lin1878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin1878
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Formyltransferase 3.66e-55
Family Formyltransferase 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin1878
Sequence length 188
Comment (Listeria innocua)
Sequence
MNIAIFASGNGSNFQALVDDELIKPHVKLLVCDKPNAYVVERANKQNIPVFLFDVKNYPD
KEAFETEILLELRGLEIDLLVLAGYMRLIGPTLLAEFPEQIVNLHPSLLPAFKGKDAIGQ
AIEAKVSETGVTAHFVDAGMDTGPMIDQVKVVVAKTETADSLAEKIHQVEHIFYPKVIRG
LIQNGGND
Download sequence
Identical sequences H1G7X4 Q92AP2
WP_003762851.1.46653 WP_003762851.1.51650 WP_003762851.1.67429 WP_003762851.1.70104 WP_003762851.1.83607 WP_003762851.1.99521 gi|16800944|ref|NP_471212.1| 272626.lin1878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]