SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272630.MexAM1_META1p1198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272630.MexAM1_META1p1198
Domain Number 1 Region: 281-427
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-23
Family Histidine kinase 0.004
Further Details:      
 
Domain Number 2 Region: 209-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000122
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Weak hits

Sequence:  272630.MexAM1_META1p1198
Domain Number - Region: 113-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0811
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272630.MexAM1_META1p1198
Sequence length 438
Comment (Methylobacterium extorquens AM1)
Sequence
MRSLRVRLFAILVLATGLIWLSAVAWIYLGSKREVEQVLDNRLQEAARMVSSLVGAVGGT
DPNGGPRTFPAPTAYERQLSCQIWSLDGRMVARSTGAPERRLTDAPAGFSQREVDGETWR
VFTVEDAERGVRVMVGDRLGLRERLVTDLIMGLVTPAILMVPLLGMLIWASLGRGLRPLW
LMARDLAGRGADDMSAIDTNLAPAEVRPLADALNGLFLKVESARRHEREVTAFAAHELRT
PLAGLKVQAQVAMAATDPDVAKAALRQILAAVDRTTRLVRQLLDAARLDAAGDAPSLAEV
DVGALVTETVEGMRTPPGVQTQIDPGLRGYTLLADPEGLRLAVRNLHENAVQHMETGTVA
WVALPDGRGIVVRDEGPGIPEDELPHVTTRFFRGRHKSATGSGLGLAIAEMASRRSGLSL
RLRNRTDRPGLEAEILPG
Download sequence
Identical sequences C5AY10
272630.MexAM1_META1p1198 gi|240137868|ref|YP_002962340.1| WP_012752373.1.3851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]