SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272630.MexAM1_META1p2916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272630.MexAM1_META1p2916
Domain Number 1 Region: 98-244
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000034
Family Multidrug-binding domain of transcription activator BmrR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272630.MexAM1_META1p2916
Sequence length 253
Comment (Methylobacterium extorquens AM1)
Sequence
MTRLATLAAGLLALVPSLTTASLAQNAPPPTNAPSPAEANPLPTTTVPDTTKSGPDPAAP
SPQQVPIPRPAQAGAAQAVTPPPSALPTLVTVPGEPNDVDEVTLPAKPVAILAGETKWEE
ARANLRKAYKTIGETLAKLNLKQAGRPIALFTKTEDDGFQYEAMIPIEAAPAQGAEGGDV
KFGSNPSGKALRFKHSGSYEEIDGTYETLIAYLDAKEIAVQDRFLEEYVTDLGEGADDKL
DINIYALPKEPAK
Download sequence
Identical sequences C5AUQ8 H1KGR5
gi|240139470|ref|YP_002963945.1| WP_004446528.1.1114 WP_004446528.1.26548 WP_004446528.1.32918 WP_004446528.1.3851 WP_004446528.1.82277 272630.MexAM1_META1p2916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]