SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272633.MYPE4170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272633.MYPE4170
Domain Number 1 Region: 25-108
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.00000000000144
Family GIY-YIG endonuclease 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272633.MYPE4170
Sequence length 113
Comment (Mycoplasma penetrans)
Sequence
MKVFDEDGFLDLRHEMNFSKKDIFKGVYIIWNKTKNLYYVGQSKNVNKRIFRDHFNNNDV
KNIIFAKDWWNGDDFYYKTIECETKDELDSLEKELIEKYNSFVSGYNKTGGNV
Download sequence
Identical sequences Q8EVZ0
WP_011077243.1.43808 272633.MYPE4170 gi|26553869|ref|NP_757803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]