SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272635.MYPU_0850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272635.MYPU_0850
Domain Number - Region: 109-158
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00628
Family NfeD domain-like 0.014
Further Details:      
 
Domain Number - Region: 42-84
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.0366
Family Mitochondrial carrier 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272635.MYPU_0850
Sequence length 163
Comment (Mycoplasma pulmonis)
Sequence
MDTIQIILIVFWSLVILITLVIELLTFGIFSSIITIAAIPSLIIATSGPLEWYWMFLQFV
IFIFLFVILYFSFYKAVKKYLAKMTLFKGPIQDIVGTKTKLLISCNETNEDINNYGSVSI
NGKNYRTLSEVGEGKIEKDNIVEISAIRGTTLFVKKVSQNILS
Download sequence
Identical sequences Q98RC4
gi|15828556|ref|NP_325916.1| WP_010924889.1.72207 272635.MYPU_0850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]