SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272831.NMC1115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272831.NMC1115
Domain Number - Region: 85-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000157
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272831.NMC1115
Sequence length 139
Comment (Neisseria meningitidis FAM18)
Sequence
MGKCMTVWFVAAVAVLIIELLTGTVYLLVVSAALAGSGIAYGLTGSTPAAVLTAALLSAL
GIWFVHAKTAVGKVETDSYQDLDAGQYVEILRHTGGNRYEVFYRGTHWQAQNTGQEELEP
GTRALIVRKEGNLLIIANP
Download sequence
Identical sequences A1KU25
gi|121634909|ref|YP_975154.1| 272831.NMC1115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]