SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272844.PAB0371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272844.PAB0371
Domain Number 1 Region: 60-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000889
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272844.PAB0371
Sequence length 124
Comment (Pyrococcus abyssi)
Sequence
MLNFLKILAILSDEIAVLVFFLLILPELGFNIPLKLVLILVSILVLKDALLIKLFLDVLK
KKPEVGIEGLIGERGIVVEDLTPEGMIKVRGELWRARAISGSIKKREAVKVIRVEGNIMI
VERW
Download sequence
Identical sequences Q9V188
272844.PAB0371 WP_010867664.1.84333 gi|14520756|ref|NP_126231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]