SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272844.PAB1126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272844.PAB1126
Domain Number 1 Region: 141-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.14e-127
Family Enolase 0.000000102
Further Details:      
 
Domain Number 2 Region: 9-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.63e-58
Family Enolase N-terminal domain-like 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272844.PAB1126
Sequence length 430
Comment (Pyrococcus abyssi)
Sequence
MTMENPYEIVAVIAREILDSRGNPTVEVDVHTPISMGRAAVPSGASTGTHEAVELRDGGK
RYHGKGVRRAVENVNKIIAPELVGMDVRWQREIDRLLIELDGTENKSNLGANAILAVSLA
VAKAAANALELPLYQYLGGVNAYVLPVPLSNVINGGVHAGNDLDFQEFMIMPIGANSFRE
AIRWVSETYHVLKKVIAEKYGKNAVNVGDEGGFAPPMKEVTEPLDVLIKAIEEAGYKPGE
EIALALDAASSEFYKDGKYIVSGKEYTREELLELYKELTSTYPIVSIEDPFHEEDWEGFV
MITRELGKKVQIVGDDLFVTNPKRLKKGIEMGAANALLLKVNQIGTLTEAMDAAYMAFRA
GYGVVVSHRSGETEDATIADLAVALNAGQIKTGAPARSDRNAKYNQLIRIEEELEGVAVY
AGKNFRKVFF
Download sequence
Identical sequences gi|14521916|ref|NP_127393.1| 272844.PAB1126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]