SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272844.PAB1325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272844.PAB1325
Domain Number 1 Region: 73-141
Classification Level Classification E-value
Superfamily NfeD domain-like 3.14e-23
Family NfeD domain-like 0.000047
Further Details:      
 
Weak hits

Sequence:  272844.PAB1325
Domain Number - Region: 11-96
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0628
Family ABC transporter transmembrane region 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272844.PAB1325
Sequence length 147
Comment (Pyrococcus abyssi)
Sequence
MMTMDALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISA
VLSYMAFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELK
VGDTIVVEDVDGVKLKVRKAPRSRSPQ
Download sequence
Identical sequences Q9UYE5
272844.PAB1325 gi|14521761|ref|NP_127237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]