SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272844.PAB1932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272844.PAB1932
Domain Number 1 Region: 24-186
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.24e-30
Family Clp protease, ClpP subunit 0.021
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily NfeD domain-like 6.41e-16
Family NfeD domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272844.PAB1932
Sequence length 440
Comment (Pyrococcus abyssi)
Sequence
MKKIILPLLVFAFIASPVLAGNVVYVAQIKGQITSYTYDQFDRYITIAEENNAEAIIIEF
DTPGGRADAMMNIIQRIQQSKVPVIIYVYPPGATAASAGTYIALGSHLIAMAPGTSIGAC
RPILGYSQNGSIIEAPPKITNHFIAYIKSLAQESGRNETIAEEFITKDLSLTPEEALKYG
VIEVIARDVNELLGKANGMKTKLPVNGRYVTLNFTNVDVKYLSPSLKDKLIMYITDPNVA
YLLLTLGIWALIIGFLTPGWHVPETVGAIMVILAIIGFGYFGYNSAGILLIIIAMLFFVA
EALTPTFGLFTVAGLITFIIGGILLFGGGEEYLIKREVFSQLRILIITVGVILAAFFAFG
MAAVIRAHRRKASTGREEMIGLTGTVVEELNPEGMVKVRGELWRARSKFGEKIEKGERIK
VVDIEGLTLIVVREGKGGER
Download sequence
Identical sequences Q9V0Y0
272844.PAB1932 WP_010867774.1.84333 gi|14520866|ref|NP_126341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]