SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272943.RSP_2491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272943.RSP_2491
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.94e-124
Family Enolase 0.0000000231
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.08e-58
Family Enolase N-terminal domain-like 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272943.RSP_2491
Sequence length 425
Comment (Rhodobacter sphaeroides 2 4 1)
Sequence
MSTIIDIHAREILDSRGNPTVEVDVTLESGAFGRAAVPSGASTGAHEAVEKRDGDKSRYM
GKGVLEAVAAVNGEIAEMLVGFDATEQVGIDRTMIEMDGTPNKGRLGANAILGVSLAVAK
AAAEFTNQPLFRYVGGSSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAQNVREAIR
MGSEVFHTLKKELAAGGFNTGIGDEGGFAPNISSTREALDYILRSIEKAGYKPGEDIYLA
LDCASTEYFKGGKYEMKGEGKSLTSAENVDYLAALCADYPIISIEDGCAEDDWEGWKLLT
DKLGAKVQLVGDDLFVTNPKRLEQGIKAGVANSMLVKVNQIGSLTETLMAVDMAHRARYT
NVMSHRSGETEDATIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEMLGEVAEYAGR
SILKV
Download sequence
Identical sequences A0A1E3D3Y6 A0A239D2A2 A3PIV3 B9KQU4 Q3J3H9
gi|77463052|ref|YP_352556.1| WP_002719649.1.19875 WP_002719649.1.22285 WP_002719649.1.22689 WP_002719649.1.29994 WP_002719649.1.39940 WP_002719649.1.46944 WP_002719649.1.58819 WP_002719649.1.62547 WP_002719649.1.80699 WP_002719649.1.8565 YP_352556.1.90827 gi|221638910|ref|YP_002525172.1| 272943.RSP_2491 349101.Rsph17029_1159 557760.RSKD131_0811 gi|126461927|ref|YP_001043041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]