SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272994.SPAB_01578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272994.SPAB_01578
Domain Number 1 Region: 120-313
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-52
Family D-glucarate dehydratase-like 0.0000000404
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.6e-32
Family Enolase N-terminal domain-like 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272994.SPAB_01578
Sequence length 321
Comment (Salmonella enterica serovar Paratyphi B SPB7)
Sequence
MRSVKVYEETWPLHTPFVIARGSRSEAHVVVVELEEEGVKGIGECTPYPRYGESDASVMA
QIMSIVPQLENGLTREALQKLLPAGAARNAVDSALWDLQARQQQQSLAGLLGVTLAPVFT
TAQTVVIGTPEQMAASAAALWEKGATLLKIKLDARLISERMVAIRSAVPEATLIVDANES
WRPEGLAARCQLLADLNVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSSLKALTGR
YDMINIKLDKTGGLTEALALATEAREQGFGLMLGCMLCTSRAISAALPLMPQVSFADLDG
PTWLAVDVEPALRFTTGQLHL
Download sequence
Identical sequences A0A2I6TKQ2 M7S036
272994.SPAB_01578 439851.SeD_A1651 gi|198244730|ref|YP_002215463.1| gi|549479455|ref|YP_008613466.1| WP_001258067.1.100017 WP_001258067.1.101042 WP_001258067.1.101223 WP_001258067.1.101724 WP_001258067.1.101841 WP_001258067.1.10191 WP_001258067.1.101927 WP_001258067.1.10521 WP_001258067.1.1239 WP_001258067.1.13429 WP_001258067.1.14041 WP_001258067.1.15046 WP_001258067.1.15214 WP_001258067.1.1601 WP_001258067.1.1689 WP_001258067.1.17755 WP_001258067.1.1990 WP_001258067.1.20767 WP_001258067.1.21616 WP_001258067.1.22590 WP_001258067.1.22845 WP_001258067.1.2376 WP_001258067.1.24392 WP_001258067.1.24803 WP_001258067.1.25421 WP_001258067.1.2568 WP_001258067.1.25709 WP_001258067.1.26532 WP_001258067.1.26587 WP_001258067.1.27342 WP_001258067.1.27513 WP_001258067.1.27616 WP_001258067.1.27755 WP_001258067.1.2825 WP_001258067.1.29274 WP_001258067.1.29923 WP_001258067.1.30238 WP_001258067.1.3067 WP_001258067.1.31845 WP_001258067.1.31983 WP_001258067.1.32902 WP_001258067.1.33865 WP_001258067.1.34684 WP_001258067.1.35332 WP_001258067.1.35619 WP_001258067.1.3572 WP_001258067.1.36978 WP_001258067.1.3726 WP_001258067.1.3756 WP_001258067.1.38881 WP_001258067.1.38895 WP_001258067.1.39414 WP_001258067.1.39614 WP_001258067.1.40158 WP_001258067.1.40284 WP_001258067.1.41345 WP_001258067.1.4141 WP_001258067.1.41434 WP_001258067.1.4239 WP_001258067.1.43528 WP_001258067.1.44397 WP_001258067.1.44578 WP_001258067.1.4592 WP_001258067.1.47817 WP_001258067.1.48268 WP_001258067.1.49175 WP_001258067.1.50905 WP_001258067.1.52047 WP_001258067.1.52336 WP_001258067.1.52858 WP_001258067.1.54469 WP_001258067.1.55418 WP_001258067.1.55706 WP_001258067.1.55853 WP_001258067.1.56368 WP_001258067.1.56950 WP_001258067.1.57125 WP_001258067.1.58157 WP_001258067.1.58749 WP_001258067.1.59097 WP_001258067.1.59335 WP_001258067.1.59512 WP_001258067.1.60608 WP_001258067.1.6108 WP_001258067.1.61509 WP_001258067.1.62076 WP_001258067.1.62222 WP_001258067.1.62245 WP_001258067.1.64121 WP_001258067.1.64674 WP_001258067.1.66122 WP_001258067.1.66289 WP_001258067.1.66820 WP_001258067.1.66937 WP_001258067.1.67776 WP_001258067.1.67905 WP_001258067.1.68690 WP_001258067.1.68958 WP_001258067.1.69346 WP_001258067.1.7016 WP_001258067.1.70303 WP_001258067.1.70914 WP_001258067.1.70929 WP_001258067.1.70977 WP_001258067.1.71248 WP_001258067.1.71600 WP_001258067.1.72107 WP_001258067.1.72182 WP_001258067.1.72351 WP_001258067.1.72470 WP_001258067.1.72625 WP_001258067.1.72872 WP_001258067.1.73764 WP_001258067.1.74639 WP_001258067.1.75180 WP_001258067.1.77067 WP_001258067.1.77436 WP_001258067.1.77754 WP_001258067.1.79757 WP_001258067.1.79914 WP_001258067.1.79951 WP_001258067.1.80479 WP_001258067.1.80609 WP_001258067.1.81455 WP_001258067.1.82395 WP_001258067.1.83516 WP_001258067.1.8425 WP_001258067.1.85742 WP_001258067.1.86159 WP_001258067.1.86240 WP_001258067.1.86389 WP_001258067.1.86807 WP_001258067.1.86860 WP_001258067.1.87760 WP_001258067.1.87936 WP_001258067.1.88165 WP_001258067.1.88698 WP_001258067.1.88982 WP_001258067.1.89632 WP_001258067.1.92529 WP_001258067.1.92754 WP_001258067.1.93410 WP_001258067.1.93691 WP_001258067.1.94039 WP_001258067.1.94352 WP_001258067.1.94982 WP_001258067.1.94983 WP_001258067.1.95558 WP_001258067.1.95579 WP_001258067.1.96490 WP_001258067.1.96584 WP_001258067.1.97480 WP_001258067.1.99577 CP000886|CDS_1346781-1347746 CP001144|CDS_1593137-1594102 gi|161613843|ref|YP_001587808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]