SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272994.SPAB_03012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272994.SPAB_03012
Domain Number - Region: 167-233
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000167
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.02
Further Details:      
 
Domain Number - Region: 77-151
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000647
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272994.SPAB_03012
Sequence length 240
Comment (Salmonella enterica serovar Paratyphi B SPB7)
Sequence
MRSVPRRERHRRLRNAKDCACRYHSPTPQIFDRLELLNQQLNYALPVGIISQAIITTDNY
LGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMEALPVSCIEALNQLRALSWQ
QSDIQIYLLVSDKTPAITQFIRMAGRFFVLSRQQNLASVREALLSAAKPRLSESFSRTDW
LMIETLAQGASLKEIARQQSVPYHRVVYRLKQLITLLNLPHRQSFLRLIQQLNVTFHDIF
Download sequence
Identical sequences CP000886|CDS_2505870-2506592 272994.SPAB_03012 WP_001258119.1.101042 WP_001258119.1.101841 WP_001258119.1.10191 WP_001258119.1.10521 WP_001258119.1.12456 WP_001258119.1.16244 WP_001258119.1.17865 WP_001258119.1.30238 WP_001258119.1.30246 WP_001258119.1.32277 WP_001258119.1.3445 WP_001258119.1.34817 WP_001258119.1.3756 WP_001258119.1.39723 WP_001258119.1.4239 WP_001258119.1.42767 WP_001258119.1.43535 WP_001258119.1.4775 WP_001258119.1.48876 WP_001258119.1.49276 WP_001258119.1.52047 WP_001258119.1.57735 WP_001258119.1.58698 WP_001258119.1.59125 WP_001258119.1.62486 WP_001258119.1.6594 WP_001258119.1.7010 WP_001258119.1.70914 WP_001258119.1.71248 WP_001258119.1.82395 WP_001258119.1.94352 WP_001258119.1.95289 WP_001258119.1.95840 gi|161615243|ref|YP_001589208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]