SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273036.SAB1446c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273036.SAB1446c
Domain Number 1 Region: 171-234
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000719
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273036.SAB1446c
Sequence length 235
Comment (Staphylococcus aureus RF122)
Sequence
MSYNNFLQMTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTL
GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
Download sequence
Identical sequences A0A0E1AGS8 A0A0E1VQZ2 A0A0E1X4W0 A0A0H2WYV6 A0A0H3JZN5 A0A0H3K0C7 A0A0H3KGR8 A0A2H5AP64 W8U5J3
gi|269203202|ref|YP_003282471.1| gi|470224856|ref|YP_007623435.1| gi|387602915|ref|YP_005734436.1| gi|470197331|ref|YP_007583732.1| 158878.SAV1574 196620.MW1526 273036.SAB1446c 282458.SAR1651 282459.SAS1512 359786.SaurJH9_1632 359787.SaurJH1_1666 418127.SAHV_1561 426430.NWMN_1477 451516.USA300HOU_1575 681288.SAAV_1566 93062.SACOL1631 gi|404478925|ref|YP_006710355.1| gi|545637912|ref|YP_008588088.1| gi|537442881|ref|YP_008485458.1| gi|379021356|ref|YP_005298018.1| gi|387150717|ref|YP_005742281.1| gi|151221689|ref|YP_001332511.1| gi|387143181|ref|YP_005731574.1| gi|21283255|ref|NP_646343.1| gi|161509802|ref|YP_001575461.1| gi|82751177|ref|YP_416918.1| gi|514066508|ref|YP_008128428.1| gi|470193400|ref|YP_007579753.1| gi|532359666|ref|YP_008449495.1| gi|386831184|ref|YP_006237838.1| gi|57651967|ref|YP_186471.1| gi|470191435|ref|YP_007577745.1| gi|470195366|ref|YP_007581718.1| gi|479329584|ref|YP_007868643.1| gi|385781859|ref|YP_005758030.1| gi|384870115|ref|YP_005752829.1| gi|148268058|ref|YP_001247001.1| gi|379014782|ref|YP_005291018.1| gi|49486409|ref|YP_043630.1| gi|150394126|ref|YP_001316801.1| gi|384862175|ref|YP_005744895.1| gi|470219068|ref|YP_007619462.1| gi|15924564|ref|NP_372098.1| gi|545635053|ref|YP_008585623.1| gi|384864795|ref|YP_005750154.1| gi|384867452|ref|YP_005747648.1| gi|49483822|ref|YP_041046.1| gi|521212389|ref|YP_008168735.1| gi|156979892|ref|YP_001442151.1| gi|470199299|ref|YP_007585699.1| WP_000121237.1.54438 gi|554644381|ref|YP_008716172.1| gi|470222889|ref|YP_007621446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]