SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273057.SSO2069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273057.SSO2069
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273057.SSO2069
Sequence length 194
Comment (Sulfolobus solfataricus)
Sequence
MAWVNILIAGVGGQGIITAGKIIAEAGNYSNTKVLIAETHGLAQRGGGVNVHVRIGDVNS
PLIPLGKADYLVGLEAIEVLRNLNYASRKHTTIVVNNYVVRPVLPKVKLLTLQEIFDKLK
GCKVYVIDANQIAIKAGNIKAANAAMLGFLYSLGAFEGLINEESFIKALKYESNIKAFKI
AQAIKINGIDINGI
Download sequence
Identical sequences A0A0E3MFE2 D0KPW6 Q97WQ1
gi|15898856|ref|NP_343461.1| gi|384435113|ref|YP_005644471.1| WP_009990192.1.14611 WP_009990192.1.22626 WP_009990192.1.43719 WP_009990192.1.57434 WP_009990192.1.66040 WP_009990192.1.8449 WP_009990192.1.93834 273057.SSO2069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]