SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273057.SSO2665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273057.SSO2665
Domain Number 1 Region: 106-371
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-78
Family D-glucarate dehydratase-like 0.0000209
Further Details:      
 
Domain Number 2 Region: 3-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.4e-25
Family Enolase N-terminal domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273057.SSO2665
Sequence length 393
Comment (Sulfolobus solfataricus)
Sequence
MTKISEIEAYILGKEVTSAQWASLMVLVRVTTNDGRVGWGETVSALRAEAVANFVKKINT
VLKGNDVFNVEKNRLEWYKHDFNMTISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGK
TRDKVLVYANGWYQNCVKPEDFAEKAKEIVKMGYKALKFDPFGPYFNDISKKGLDIAEER
VKAVREAVGDNVDILIEHHGRFNANSAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNN
TSLRIALGERIINKQQALYFMKEGLVDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHN
AQGPILNAVTLQFDAFIPNFLIQESFYDWFPSWKRELIYNGTPIDNGYAIIPERPGLGVE
VNEKMLDSLKVKGEEYFNPEEPVWVVKGTWRDY
Download sequence
Identical sequences A0A0E3JWC5 D0KNY8 Q97VG1
WP_009988582.1.14611 WP_009988582.1.22626 WP_009988582.1.43719 WP_009988582.1.57434 WP_009988582.1.66040 WP_009988582.1.8449 WP_009988582.1.93834 273057.SSO2665 gi|15899388|ref|NP_343993.1| NYSGXRC-9271a gi|384433001|ref|YP_005642359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]