SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273063.ST2206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST2206
Domain Number 1 Region: 80-141
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-17
Family NfeD domain-like 0.0015
Further Details:      
 
Weak hits

Sequence:  273063.ST2206
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0621
Family Aquaporin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.ST2206
Sequence length 147
Comment (Sulfolobus tokodaii)
Sequence
MIARNIIRNIAKIFIKIFFYRLLLNIMVSHIVIPIIIIAIVIAALVLTGEYANPIVAIPS
MAIVGFISYRIGYVIYKTRKRNLYTYVGKIGKAIEDIPLNGEGYVVIEGEMWKAIAEEPI
VEGDRVIITGMEGLKLRVKKLTSDGKN
Download sequence
Identical sequences gi|15922534|ref|NP_378203.1| 273063.ST2206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]