SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273063.ST2561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST2561
Domain Number 1 Region: 111-351
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.31e-51
Family D-glucarate dehydratase-like 0.0004
Further Details:      
 
Domain Number 2 Region: 8-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000269
Family Enolase N-terminal domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.ST2561
Sequence length 370
Comment (Sulfolobus tokodaii)
Sequence
MKVSILPASIPYVDNPMPEWVDEWGVQLFTKVNLGDYAGYGEVLIAGSGIISAYIGVFED
LIIPYLENVEVVSINEVVEKLEKMLYSAGLCSITLGSISGVETALWHVFSKMRNMKIYEF
FGGKVRDRVPVYASFPRYKSVDDIVSAVKVAINRGFTLVKLHQQPQMIEDALKKIREIFG
FEIKIAIDFNSAFDYSSALSFLNKIHRYEIEWYEEPIYPPNDYDNLKRLAEKFPISAGEN
EYTINSFRKLIESGIEYVQPDISKIGGYLKMIKVIDLAESYGVKVMPHLRPQRSGIALFH
TLQLALAKRNIVQVEFPLAQIPSELFNAEFNINNGLVKVPEDVSLNEEILREKYNFTRKL
RILKFADLAT
Download sequence
Identical sequences Q96XF6
273063.ST2561 WP_010980646.1.60790 NYSGXRC-9288b gi|15922894|ref|NP_378563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]