SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273068.TTE0385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE0385
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.79e-26
Family Clp protease, ClpP subunit 0.029
Further Details:      
 
Domain Number 2 Region: 367-434
Classification Level Classification E-value
Superfamily NfeD domain-like 2.75e-18
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE0385
Sequence length 441
Comment (Thermoanaerobacter tengcongensis)
Sequence
MFTMRKILLTTILLVFIILPPSSLQATSTQNPVYVLTVDGPIVPVVADYIESGFKAAERD
GASCIVIELSTPGGLYTTTQKIVTQILNSPIPVVVYVSPAGAWAGSAGTFITLSANIAAM
APGSRIGAAHPVSIEDDSAMSEIQRQKITHDAAAWIRSIAENRGRDPKNAEMAVVESRSF
TDTEALNANLIDLRANNLNDLLKKINGKTVKNFDGTTITLKTDGPIRYYPMTSVQKFLFA
ISDPNIAYLLMSAGILGIILELYHPGAIFPGVAGGISLLLGLYTLGTLDAQLSGMLLVIL
GLVLLASEAFVVSHGILAVGGIISFVLGSLMLFSGNQMGLTINKGVVFATAFFMAAFVSF
LLAAVIRAQKRKVVTGIEGMIGEFGTAVTDIAPKGTVLVEGERWQAVSKEPIKKGEKVVI
IGVEGLTLKVQKVKEGGNESD
Download sequence
Identical sequences Q8RCN5 U5CRL7
WP_011024829.1.70758 WP_011024829.1.99938 gi|20806897|ref|NP_622068.1| 273068.TTE0385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]