SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273068.TTE0961 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE0961
Domain Number 1 Region: 181-439
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.66e-67
Family Pyruvate oxidase and decarboxylase Pyr module 0.04
Further Details:      
 
Domain Number 2 Region: 1-205
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.01e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.009
Further Details:      
 
Domain Number 3 Region: 451-557
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.77e-22
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE0961
Sequence length 559
Comment (Thermoanaerobacter tengcongensis)
Sequence
MDYTILIGGEAGQGIDTTANLLAKILKRHGFYVFSNSDYMSRIRGGHNFIQVRFSDKPLH
SHISKNDIIFALNKETIEIHSKNLTKTGVIICDKDIPLEGIKGKALALPLLETAKELKNQ
KVFTTVGLGVILKYFSLDFSIGEKAIKEEFNKDIAELNLQALKKGYDLIDTEISLKTSED
KNILINGNQAVALGAIAAGCKFYCGYPMTPSTGILTFMSYHSNEMGIAVEQVEDEIAALN
MALGASYAGVRAMTGSSGGGFALMVEALSLAGMIEVPVVVIDVQRPAPATGFPTRTEQAD
LQFVIHAGHGEFTRMVIALRDVEDAFYQTARAFNIAEKYQIPVLLLSDQHLADSLKTVNS
FDFDKITIERYISGEEAITEEEYKRYKITPTGISPRILPGKIPGQVVLVDSDEHDEWGHI
TESAEIRKAMVDKRLRKFEYLKEEIQEPWFIGKENPKNLIIGWGSTYGAIKEAVENLVDE
GLSVGALIFGDIWPLPTQRLLELSKNAKKIIDIEQNATGQLEKLIRQEVLIKATHKILKY
DGRPFSSDEIYDKLKEVLV
Download sequence
Identical sequences Q8RB62
273068.TTE0961 gi|20807442|ref|NP_622613.1| WP_011025336.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]