SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273068.TTE1048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE1048
Domain Number 1 Region: 19-123
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE1048
Sequence length 127
Comment (Thermoanaerobacter tengcongensis)
Sequence
MDKKEGATMKNKVVPTIKLYDYLLVPIQIELDDNTVERLQMQILHEIHEKEVRGIIIDVS
MVDVIDSYISFVLSETAGMAKAMGCYVVICGIQPQVALTLSQMGIKLKDIITAQSLEDAI
NILDKLE
Download sequence
Identical sequences Q8RAY5 U5CUS4
WP_011025411.1.70758 WP_011025411.1.99938 273068.TTE1048 gi|20807523|ref|NP_622694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]